KEGG   Lactobacillus kunkeei: APS55_02395Help
Entry
APS55_02395       CDS       T04112                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lku  Lactobacillus kunkeei
Pathway
lku00071  Fatty acid degradation
lku00072  Synthesis and degradation of ketone bodies
lku00280  Valine, leucine and isoleucine degradation
lku00362  Benzoate degradation
lku00380  Tryptophan metabolism
lku00620  Pyruvate metabolism
lku00630  Glyoxylate and dicarboxylate metabolism
lku00640  Propanoate metabolism
lku00650  Butanoate metabolism
lku00900  Terpenoid backbone biosynthesis
lku01100  Metabolic pathways
lku01110  Biosynthesis of secondary metabolites
lku01120  Microbial metabolism in diverse environments
lku01130  Biosynthesis of antibiotics
lku01200  Carbon metabolism
lku01212  Fatty acid metabolism
lku02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lku00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APS55_02395
   00630 Glyoxylate and dicarboxylate metabolism
    APS55_02395
   00640 Propanoate metabolism
    APS55_02395
   00650 Butanoate metabolism
    APS55_02395
  09103 Lipid metabolism
   00071 Fatty acid degradation
    APS55_02395
   00072 Synthesis and degradation of ketone bodies
    APS55_02395
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    APS55_02395
   00310 Lysine degradation
    APS55_02395
   00380 Tryptophan metabolism
    APS55_02395
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    APS55_02395
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    APS55_02395
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    APS55_02395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lku04147]
    APS55_02395
Enzymes [BR:lku01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     APS55_02395
Exosome [BR:lku04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   APS55_02395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ALJ31145
UniProt: A0A087ERA2
Position
559214..560392
Genome map
AA seq 392 aa AA seqDB search
MEKVVIAAAKRTPIGKINGALKNFTSVDLGTIVTKAVIEQANIKPSDVDQVVFGNVIQAG
AGQNISRQIEINSNIPYCSTANTVNQVCGSGLKAVRNAQAAIVMGDADVVIAGGVESMSN
APFLNMDVRSGHKFGDVTLVDSLNKDALMDAFNKQPMGVTAENVAEKFNVSREEQDEFAY
QSHMKAAKAFDNGYFDKELVPIEIKNRKSSYIMKEDENIRRDTSIEVLNKLRPAFKEDGT
VTAGNAASLNDGASALVLMSESAAKRLNVKPLAVIDGYAEAGCDPDYMGYAPYDATKSLF
DKLNITIDDIDLVELNEAFAAQVLAVAHDYNIDMDKLNISGGAISMGHPLGDSGARIVGS
LIYNLQRTNKKSGLATICIGGGMGMAMKITLL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtcgtgattgctgctgccaagagaacaccgattggtaagatcaacggtgcc
ctaaagaacttcacttctgtggatttaggaaccattgttaccaaggctgtaattgaacaa
gcaaacattaaaccatctgatgtggatcaagtcgtgtttggaaatgtcatccaagcaggt
gctggtcaaaacatctcaagacaaatcgaaatcaattcaaacatcccctactgtagtact
gccaatacagttaaccaagtatgtggttccggactaaaggctgtccgcaatgctcaagct
gccatcgtaatgggtgacgctgacgtcgtaattgccggtggagtggaaagtatgtccaat
gcaccatttctaaacatggatgttagatccggtcataagtttggtgacgttactttagtc
gattcattaaacaaagacgcattaatggatgcttttaacaaacaaccaatgggagttacc
gcagaaaacgttgctgaaaagttcaacgtttcaagagaagaacaagacgagttcgcctac
caatctcatatgaaggctgccaaagcatttgataatggatactttgacaaagagctagta
ccaattgaaatcaaaaacagaaaatcttcttatattatgaaggaagatgaaaacattcgt
cgtgatacttctattgaagtccttaacaaactacgtcctgccttcaaggaagacggaact
gtgactgccggaaacgcggctagtctaaacgacggtgcatctgctttagtcctaatgagt
gaatcagccgctaagcgtttgaatgtcaaaccactagcggtcatcgatggctatgccgaa
gcaggatgtgatcctgactacatgggatacgctccttatgacgctaccaagtcattattt
gataaactaaacatcactattgatgatatcgacctagtcgaactaaatgaagcattcgct
gctcaagtcctagcggttgctcacgactacaatatcgatatggacaaacttaacatctct
ggtggtgccatctcaatgggacatcccctaggtgattccggtgcgcgaattgtcggttca
ttaatctataacctacaacgcactaacaaaaaaagcggtctagctaccatctgtatcggt
ggtggtatgggaatggccatgaaaatcacactactatag

DBGET integrated database retrieval system