KEGG   Lactococcus lactis subsp. lactis Il1403: L47248
Entry
L47248            CDS       T00045                                 
Symbol
pi101
Name
(GenBank) prophage pi1 protein 01, integrase
Organism
lla  Lactococcus lactis subsp. lactis Il1403
SSDB
Motif
Pfam: Phage_integrase Arm-DNA-bind_4 Phage_int_SAM_1 Peptidase_M32 Phage_int_SAM_4 Integrase_1
Other DBs
NCBI-ProteinID: AAK04534
UniProt: Q9CIC8
Position
complement(447236..448369)
AA seq 377 aa
MARYIKRGKVWQYEISYKDTDGKYKKLRKSGFPKKADAISEAGEIEANLAKGFYTVSQDI
LLTDHFKQWIEIFKKGKVSDGTYRKYLYTLSVLKKHFSTATIKTMNRVKYQEMLNEFAEG
HSDSSVKQINVHVRASLENLLDDFIIKNDFTKGAISKGGKGSKSAELKYLDFEDFTKLIA
LAKEKINPIYSSSFMIYIAAMTGMRFSELLGLTWDNVDFEKGQIYVKRTWDIYKNNFAPT
KNDQSVRFLAIDSSTMQVMINYKEQQEKLLKRLEIEPEHPFVFYNIKNGLITNNSLNKQL
RNMCKKLGFKKIITCHGLRHTHASTMLYKGINILYVSKRLGHSSLNVTMSVYSHILKELE
EKDNENIKKIFSEINDE
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcaagatatataaaacgaggtaaagtctggcaatacgaaatatcttacaaagatact
gacggcaaatataaaaaacttagaaagagtggtttccccaaaaaggccgatgcgatttca
gaagctggtgaaattgaagctaacctagccaaaggtttttatactgtcagtcaagatatt
ttactcactgaccatttcaagcaatggatagaaatattcaaaaaaggtaaagtatcagac
ggaacttacagaaagtatttgtacacactatctgttctaaaaaagcacttttcaacagca
actattaaaacaatgaatcgtgtgaaatatcaagagatgttaaatgaatttgctgaaggt
cattccgattcatctgtgaaacaaattaatgttcatgtaagagcaagcttagaaaattta
cttgatgattttattataaaaaatgattttacaaaaggagctatttctaaaggaggaaaa
ggttcaaaaagtgctgaattaaaatatttagactttgaggacttcacaaaattaattgca
ctagctaaagaaaaaattaatcctatttactcctcatcttttatgatatacattgctgcc
atgactggtatgagatttagtgagcttttgggattgacatgggataatgtggactttgaa
aaaggacagatatacgtaaaaaggacttgggatatttataaaaataattttgcaccaact
aagaatgaccaatcagttcgttttttagccattgacagctcgactatgcaagtcatgata
aattataaggaacagcaagaaaaactcttaaaacggctcgaaattgagccagaacaccct
tttgtattctacaatatcaagaatggattgataactaataattcactcaataaacagcta
agaaatatgtgtaaaaaacttggatttaaaaaaataattacttgtcacggattaagacat
actcacgcttctactatgctttataagggaattaatattttatatgtttctaaaaggctc
ggtcatagtagtttgaacgttacaatgtcagtatattcccatatcctaaaagagcttgaa
gaaaaagataatgagaatatcaaaaaaatctttagtgaaataaacgatgagtga

DBGET integrated database retrieval system