KEGG   Lactococcus lactis subsp. lactis Il1403: L0029Help
Entry
L0029             CDS       T00045                                 

Gene name
galM
Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
lla00010  Glycolysis / Gluconeogenesis
lla00052  Galactose metabolism
lla01100  Metabolic pathways
lla01110  Biosynthesis of secondary metabolites
lla01120  Microbial metabolism in diverse environments
lla01130  Biosynthesis of antibiotics
Module
lla_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    L0029 (galM)
   00052 Galactose metabolism
    L0029 (galM)
Enzymes [BR:lla01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     L0029 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 1115659
NCBI-ProteinID: NP_268141
UniProt: Q9CE62
Structure
PDB: 

Position
complement(2061725..2062744)
Genome map
AA seq 339 aa AA seqDB search
MEIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAY
PGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQV
KFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDAS
ESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVK
GIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGG
ITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaataagagattttggcttaggaagtgacttaattagtctaaccaataaa
gcaggtgtcacaatttcttttacaaatctgggcgctcggattgttgactggcaaaaagat
ggaaagcatctgattctaggctttgattcagctaaagaatatttagaaaaagatgcctat
cctggtgcaactgttggacctacagcaggaagaattaaggatggtttggtcaaaatttct
gggaaagattatatcttaaatcaaaatgaaggccctcaaaccttacatggtggggaagaa
agtattcatactaaactttggacatatgaagttaccgatttaggagctgaagttcaagtc
aaattttccttagtttctaatgacggaacaaatggttatcctggtaaaatagaaatgtca
gtaactcattcttttgatgatgacaataagtggaaaattcattatgaggccatttctgat
aaagacactgtgtttaatccaactgggcatgtctattttaatttgaatggtgatgctagt
gaatctgttgaaaatcatggacttcgactggccgcttcaagatttgttcctttaaaagac
caaacagaaattgttcgtggtgatatcgttgatataaaaaatacagacttggatttccgt
caggaaaaacaattatcaaatgccttcaattctaatatggaacaagttcaattagttaaa
ggaattgaccatcctttcttgttagaccagttaggacttgataaagaacaagctcgttta
acgcttgatgatacttcaatttcagtctttaccgaccaaccaagtattgtgatatttaca
gcaaattttggtgatttaggaactctttatcatgagaaaaagcaagtgcaccatggtgga
attacttttgaatgtcaagtatcacctgggtctgagcaaattccagagcttggagatatc
agcctaaaagcgggagaaaaatatcaagcaaccacaatttacagcttgcatacaaaataa

DBGET integrated database retrieval system