KEGG   Lactococcus lactis subsp. lactis Il1403: L0338Help
Entry
L0338             CDS       T00045                                 

Gene name
secG
Definition
(RefSeq) preprotein translocase subunit SecG
  KO
K03075  preprotein translocase subunit SecG
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
lla02024  Quorum sensing
lla03060  Protein export
lla03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:lla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    L0338 (secG)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    L0338 (secG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    L0338 (secG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lla02044]
    L0338 (secG)
Secretion system [BR:lla02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   L0338 (secG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecG
Motif
Other DBs
NCBI-GeneID: 1114572
NCBI-ProteinID: NP_267097
UniProt: Q9CH01
Position
966520..966768
Genome map
AA seq 82 aa AA seqDB search
MEKVIYDILLVAMLVVSAFIIVAIFMQPSKQDGAADAFSGGTGELFERRKARGFEAVMQR
FTAIMIGLWLVVGFALVVLSTR
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtaatttatgacattttgcttgttgcaatgcttgtagtttcagcatttatt
attgtagcaattttcatgcaaccttcaaaacaagatggagcagcagatgctttttcgggt
ggaacaggtgaattgtttgaacgtcgtaaagcgcgcggttttgaggcagtgatgcagcgt
tttacagcaatcatgattggcttatggctagttgttggatttgctcttgttgttttatca
acacgttaa

DBGET integrated database retrieval system