KEGG   Lactococcus lactis subsp. lactis Il1403: L117145Help
Entry
L117145           CDS       T00045                                 

Gene name
butB
Definition
(RefSeq) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
lla00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    L117145 (butB)
Enzymes [BR:lla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     L117145 (butB)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     L117145 (butB)
    1.1.1.-  
     L117145 (butB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C HI0933_like Pyr_redox_2 FAD_binding_3 AlaDh_PNT_C ADH_zinc_N_2 3HCDH_N DAO NAD_binding_8 FAD_binding_2 Pyr_redox_3 RrnaAD Pyr_redox FAD_oxidored
Motif
Other DBs
NCBI-GeneID: 1114527
NCBI-ProteinID: NP_267053
Position
917431..918501
Genome map
AA seq 356 aa AA seqDB search
MRAARFYDRGDIRIDEINEPIVKAGQVGIDVAWCGICGTDLHEFLDGPIFCPSAEHPNPI
TGEVPPVTLGHEMSGVVNFIGEGVSGLKVGDHVVVEPYIVPEGTDTSETGHYNLSEGSNF
IGLGGNGGGLAEKISVDERWVHKIPDNLPLDEAALIEPLSVGYHAVERANLSEKSTVLVV
GAGPIGLLTAAVAKAQGHTVIISEPSGLRRKKAQEAQVADYFFNPIEDDIQAKVHEINEK
GVDAAFECTSVQPGFDACLDAIRMGGTVVIVAIWGKPASVDMAKLVIKEANLLGTIAYNN
THPKTIDLVSTGKIKLDQFITAKIGLDDLIDKGFDTLIHHNETAVKILVSPTGKGL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagcacgtttttacgaccgcggggatatccgcattgatgaaattaatgaacca
atagtaaaagctggccaagttggcattgatgtggcttggtgtggaatttgtggaacagat
ctccatgaatttttagatggcccaattttttgtccgtcagcagaacatcctaatccaatt
actggagaagtaccaccagtcactcttggacatgaaatgtctggggttgtaaattttata
ggtgaaggagtaagcggacttaaagtaggtgaccatgtcgttgtcgaaccttatatcgtt
cccgaagggactgatacaagtgaaactggacattataacctctcagaaggctcaaacttt
attggtttgggcggaaatggtggaggtttggctgaaaaaatttctgttgatgaacgttgg
gttcacaaaattcctgataacttaccattggatgaagctgctctaattgagccactatca
gtcggctatcacgctgttgaacgagcaaatttaagtgaaaagagtacggtattagttgtt
ggtgctggaccaattggactattaactgctgccgttgcaaaagcgcaaggacatactgtt
atcatcagtgaacctagtggacttcgtcgtaaaaaagcacaagaagcacaagttgctgat
tatttcttcaatccaattgaagatgacattcaagctaaagttcatgaaattaatgaaaaa
ggagtggacgcagcctttgaatgtacctctgtccaaccgggatttgacgcttgtctagat
gcgattcgtatgggtggaacagttgtcattgtcgcaatttggggcaagcctgctagtgtt
gatatggcaaaattagtaatcaaagaagctaaccttttaggaacgattgcttataataac
actcatccaaaaacaattgatttagtatcaacaggtaaaataaaattggaccaattcatc
acagctaaaatcggtttggatgatttgattgataaaggattcgatacgctgattcatcat
aatgaaacagctgttaaaattttagtttcaccaactggtaaaggtctataa

DBGET integrated database retrieval system