KEGG   Lactococcus lactis subsp. lactis Il1403: L150031Help
Entry
L150031           CDS       T00045                                 

Gene name
optF
Definition
(RefSeq) oligopeptide ABC transporter ATP binding protein
  KO
K10823  oligopeptide transport system ATP-binding protein
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
lla01501  beta-Lactam resistance
lla02010  ABC transporters
lla02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lla00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    L150031 (optF)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    L150031 (optF)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    L150031 (optF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lla02000]
    L150031 (optF)
Transporters [BR:lla02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    L150031 (optF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_13 AAA_21 AAA AAA_29 AAA_18 AAA_22 AAA_23 AAA_16 AAA_15
Motif
Other DBs
NCBI-GeneID: 1113959
NCBI-ProteinID: NP_266504
UniProt: Q9CIK8
Position
350025..350966
Genome map
AA seq 313 aa AA seqDB search
MMTEPKKVIEIKNLDLTFNKGKKGANKAINNVSLDIYEGETFGLVGESGSGKTTIGRAIL
KLYDNFITGGEILFEGKDVRNLKGSELREYRSEAQMIFQDPQASLNGRMRVKDIVAEGLD
ANGLVKTKAERDARVLELLRLVGLNDDHLTRYPHEFSGGQRQRIGIARALAVKPKFVVAD
EPISALDVSIQAQVVNLMRDIQAKENLTYLFIAHDLSMVKYISDRIGVMHWGKILEVGTS
DQVYNHPIHPYTKSLLSSIPSPDPISERERTPIVYDPTAELDGQEREMREITPGHFVFST
EAEAEIYKKNATV
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagaacctaaaaaagtaattgaaataaaaaaccttgatttgacttttaataaa
ggaaagaaaggggctaataaggcaattaataatgtttctttagatatttatgaaggagaa
acatttggtctcgttggagaatctggttctggtaaaacgacgattggtcgagcaattctt
aaactttatgataatttcattactggtggagaaattctctttgaaggtaaagatgttcgt
aatttaaaaggttcggagttgcgtgagtatcgttcagaagcacaaatgattttccaagat
ccacaagcttcattgaatggacggatgcgcgttaaagatatcgttgctgaaggacttgat
gctaatggtttagtaaaaacaaaggctgaacgtgatgctcgtgtattggaactcttacgt
ttggttggattgaacgatgaccatttgacacgttatccgcatgagttttctggtggacag
cgtcaacggattgggattgcacgtgcacttgccgtaaaacctaaatttgtcgtagctgat
gagcctatctcagcacttgatgtttcaattcaagctcaggttgttaacttgatgagagat
attcaagcaaaagaaaacttgacttacttgtttatcgctcatgatttgtcaatggttaaa
tatatttctgaccgaattggtgtcatgcactgggggaaaattttggaagttggaacttct
gaccaagtttacaatcatccaattcatccttatactaagagtttgctgagctcaattccg
tcaccagaccctatttctgagcgggaacgtactccaattgtttatgacccaacggctgaa
ttggatggacaagaacgtgaaatgcgggaaattactccaggacattttgttttctcaaca
gaagcagaggcagaaatttacaagaaaaacgctactgtataa

DBGET integrated database retrieval system