KEGG   Lactococcus lactis subsp. lactis Il1403: L184708Help
Entry
L184708           CDS       T00045                                 

Gene name
ywaB
Definition
(RefSeq) hypothetical protein
  KO
K03210  preprotein translocase subunit YajC
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
lla02024  Quorum sensing
lla03060  Protein export
lla03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:lla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    L184708 (ywaB)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    L184708 (ywaB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    L184708 (ywaB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lla02044]
    L184708 (ywaB)
Secretion system [BR:lla02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   L184708 (ywaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YajC OAD_gamma EphA2_TM OST3_OST6
Motif
Other DBs
NCBI-GeneID: 1115808
NCBI-ProteinID: NP_268288
UniProt: Q9CDT0
Position
complement(2201263..2201595)
Genome map
AA seq 110 aa AA seqDB search
MSGLSLIFIVVVMGGMMFFMNRQQKKQQSKRQEQLDAMQPGSEIVTIGGLHGILSSIDSA
KGTIELDCEGVILTFDRAAVKTVKSGVTPETTVVEETPAETKVESPIEEN
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcttatctcttatttttatcgttgtcgttatgggtgggatgatgttcttcatg
aaccgtcaacaaaagaaacaacaatctaaacgccaagaacaattggatgcaatgcaacca
ggttcagaaatcgtaacaattggtggattgcacggaattctttcaagcattgattcagca
aaaggaacaattgaacttgattgtgaaggtgtgattttgactttcgaccgtgcagccgta
aaaactgtaaaaagtggtgtaacaccagaaacaactgttgttgaagaaacaccggccgaa
acaaaagtggaaagcccaattgaagaaaactaa

DBGET integrated database retrieval system