KEGG   Lactococcus lactis subsp. lactis Il1403: L18872
Entry
L18872            CDS       T00045                                 
Symbol
ptcB
Name
(GenBank) cellobiose-specific PTS system IIB component
  KO
K02760  cellobiose PTS system EIIB component [EC:2.7.1.196 2.7.1.205]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
lla00500  Starch and sucrose metabolism
lla02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    L18872 (ptcB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    L18872 (ptcB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lla02000]
    L18872 (ptcB)
Enzymes [BR:lla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.196  protein-Npi-phosphohistidine---N,N'-diacetylchitobiose phosphotransferase
     L18872 (ptcB)
    2.7.1.205  protein-Npi-phosphohistidine---cellobiose phosphotransferase
     L18872 (ptcB)
Transporters [BR:lla02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    L18872 (ptcB)
SSDB
Motif
Pfam: PTS_IIB DUF2002
Other DBs
NCBI-ProteinID: AAK04511
UniProt: Q9CIF0
Position
418876..419202
AA seq 108 aa
MADKVIALACAAGMSTSLLVSKMQKAAADNGKDYEIFAKSTADIDNMLAGTGSPKPDVLL
LGPQVAFMKGEVAKKAEIAGVPMDVIKMQDYGMMRGDKVLAAAENLMN
NT seq 327 nt   +upstreamnt  +downstreamnt
atggcagataaagttattgcacttgcatgtgcagccggtatgtcaacatcacttttggta
tcaaaaatgcaaaaagcagcagcagataacgggaaagattacgaaattttcgcaaaatca
acagcggatattgataacatgcttgccggaacaggctcaccaaaacctgacgttcttctt
ttaggcccacaagttgccttcatgaaaggtgaagttgctaaaaaagctgaaatcgctggt
gtgccaatggacgttatcaaaatgcaagattatggaatgatgcgcggagataaagttctt
gcagcagctgaaaacttgatgaattaa

DBGET integrated database retrieval system