KEGG   Lactococcus lactis subsp. lactis Il1403: L19292
Entry
L19292            CDS       T00045                                 
Symbol
ptcA
Name
(GenBank) cellobiose-specific PTS system IIA component
  KO
K02759  cellobiose PTS system EIIA component [EC:2.7.1.196 2.7.1.205]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
lla00500  Starch and sucrose metabolism
lla02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    L19292 (ptcA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    L19292 (ptcA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lla02000]
    L19292 (ptcA)
Enzymes [BR:lla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.196  protein-Npi-phosphohistidine---N,N'-diacetylchitobiose phosphotransferase
     L19292 (ptcA)
    2.7.1.205  protein-Npi-phosphohistidine---cellobiose phosphotransferase
     L19292 (ptcA)
Transporters [BR:lla02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    L19292 (ptcA)
SSDB
Motif
Pfam: PTS_IIA SMBP YbjQ_1
Other DBs
NCBI-ProteinID: AAK04512
UniProt: Q9CIE9
Position
419287..419637
AA seq 116 aa
MTDKYENPTSDDYMGVVMGIIMSGGNAKGLAFQAIQQAKAGEFAEAESSLNEASEQLREA
HDVQTDLLTRLAQGEKIGWNLYMVHAQDHLMNAITFKDLAVEVVGQEQRLQALENK
NT seq 351 nt   +upstreamnt  +downstreamnt
atgactgataaatacgagaatccaacaagtgatgactacatgggtgttgtaatgggcatt
atcatgagtggaggaaatgccaaaggtttagccttccaagccattcaacaagccaaagct
ggtgaatttgccgaagctgaaagttcattaaacgaagcgagtgaacaacttcgtgaagca
catgatgttcagactgaccttttgacacgtttagctcaaggcgaaaaaattggttggaat
ctttacatggttcatgctcaagaccacttaatgaatgcgattacctttaaagaccttgct
gtagaagttgtcggtcaagaacaacgcctgcaagcacttgaaaacaaataa

DBGET integrated database retrieval system