KEGG   Lactococcus lactis subsp. lactis Il1403: L32812Help
Entry
L32812            CDS       T00045                                 

Gene name
yidC
Definition
(RefSeq) beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
lla00010  Glycolysis / Gluconeogenesis
lla00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    L32812 (yidC)
   00500 Starch and sucrose metabolism
    L32812 (yidC)
Enzymes [BR:lla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     L32812 (yidC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 1114446
NCBI-ProteinID: NP_266975
UniProt: Q9CHB3
Position
832872..834233
Genome map
AA seq 453 aa AA seqDB search
MENKMPKDFFWGNSTSSMQTEGGWNEGGKGPSVYDVNTVGRSAKDWQVTNDNYHHYSQDL
DLMKEMNMNMYRFQISWSRIVPDGDGEFNEEGIAFYNRLIDDLLARGIEPMICLYHFDMP
LNLAEKYNGFLSRKVKEAFVRFGQEMMKRFADKVKYWIVFNEHNLYFADGFEHYSGVLKK
ELTLSDMYTVFHHTMLAHCELTQFLHENFEAKIGGMLATTEIYPATFSPKDNLYLRKFDE
FYNRNLCDVYAFGHYSHEVMTYVKNQNIQMDFQKGDEEILKNGISDFISFSYYRSILLDA
SQLTENDAPNSYLTKGMKLNPLLEHNQWDWSIDPEGFRRILSRLYNEFGLPVFPIENGIG
QSEIWDGKTKIADDLRISYHQKHLEAMKKAIFTDGVEVMGYLGWGLIDIPASSGAIDKRY
GAVYVDSKSHKRIPKKSFHWFKNVFASNGDHLD
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaaatgccaaaagattttttctgggggaattcaacttcgtcaatgcaaacc
gaaggcggctggaatgaaggaggaaaagggccctctgtctatgatgtgaataccgttgga
cgttctgccaaagattggcaagtaacaaatgataattatcatcattattcccaagatcta
gatcttatgaaagaaatgaatatgaatatgtatcgtttccaaatttcttggtcacgaatt
gttcctgacggcgatggtgaatttaatgaggaaggaattgccttttataatcgtctgatt
gatgatttgcttgctcgtggaattgagcctatgatatgtctctatcatttcgatatgcca
ttaaatctggctgaaaagtacaatggttttttgagccgaaaagtgaaagaagcatttgta
agatttgggcaagaaatgatgaaaagatttgctgacaaagtcaaatattggattgttttt
aatgagcataatctttattttgctgacggttttgagcattattcgggagttttgaaaaaa
gagctgacactctctgatatgtatactgtttttcatcacaccatgcttgctcattgtgaa
ttgacccaatttttgcatgaaaattttgaagcaaaaataggaggaatgttggcgactacg
gaaatatatcccgcaactttttcaccaaaagataatttatatcttagaaaatttgatgaa
ttttataatcgaaatctctgtgatgtttatgcttttggtcattattcgcatgaggttatg
acctatgttaaaaatcagaacatccaaatggattttcaaaaaggagatgaagaaatttta
aaaaatggaatttctgactttatttctttttcttattatcgctcaattttacttgatgca
agtcagctgacagaaaatgatgcaccaaattcttatttgactaaaggaatgaaattaaat
ccgttgcttgaacataatcaatgggattggtccattgacccagaaggctttagaagaatt
ctaagtagattatataatgaatttggattgcctgtttttcctattgaaaatggcattggt
cagtcagaaatctgggatgggaaaacaaaaattgctgatgacttgagaatttcttatcat
cagaaacatcttgaagccatgaaaaaggcaatatttactgacggggtagaagttatgggt
tatcttggttggggattgattgatattcctgcttcatctggtgctattgataaacgttac
ggtgctgtttatgtggattcaaaaagtcataaacgtattccaaaaaaatcatttcattgg
tttaaaaatgtttttgcttcaaatggtgatcatttggattag

DBGET integrated database retrieval system