KEGG   Lactococcus lactis subsp. lactis Il1403: L56232Help
Entry
L56232            CDS       T00045                                 

Gene name
yqfF
Definition
(RefSeq) spermidine acetyltransferase
  KO
K00657  diamine N-acetyltransferase [EC:2.3.1.57]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
lla00330  Arginine and proline metabolism
lla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    L56232 (yqfF)
Enzymes [BR:lla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.57  diamine N-acetyltransferase
     L56232 (yqfF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_3 Acetyltransf_1 Acetyltransf_4 Acetyltransf_7 Acetyltransf_8 Acetyltransf_10 FR47 GNAT_acetyltran
Motif
Other DBs
NCBI-GeneID: 1115275
NCBI-ProteinID: NP_267771
UniProt: Q9CF66
Position
1656507..1657049
Genome map
AA seq 180 aa AA seqDB search
MTTLTNEPTMKIRALERTDLKNIHIINNKAETMRLWFEEPYESLDELTSLYDKHIHDNTE
RRFVIEANDTFIGIVELMSIDYIHRTCEIQIIIISGFSGKGYAQKALKTGVDYAFNTLNM
HKVYLWVDIDNAPAVHIYKKLGFKIEGTIKEQFFAGGRYHDSYFMGILKSEYTQREKAVK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgactacattaacaaatgaaccaacaatgaaaatcagagcattggaacggacagattta
aaaaatattcatatcatcaataataaagctgaaacaatgcggctatggtttgaagaacct
tatgaatcactagacgagttaaccagtctttatgataaacatattcatgataatactgaa
cgtcgctttgtaattgaagccaatgatacttttattggaattgtggaacttatgtctatt
gattacattcatcgtacctgcgaaattcaaatcattatcatttcaggtttttctggaaaa
ggctacgctcaaaaagcgttaaaaacaggtgttgactatgctttcaatactctaaatatg
cataaagtttatttatgggtagatattgataatgctccagctgttcatatctataaaaaa
ttaggattcaaaattgaaggaacaattaaggaacaattctttgctggcggtagatatcat
gatagctactttatggggattcttaaatctgaatatactcaaagagaaaaagcggttaaa
taa

DBGET integrated database retrieval system