KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1096
Entry
LACR_1096         CDS       T00420                                 
Name
(GenBank) Integrase
Organism
llc  Lactococcus lactis subsp. cremoris SK11
SSDB
Motif
Pfam: Phage_integrase Phage_int_SAM_3 Phage_int_SAM_5 Arm-DNA-bind_4 DUF1338 DUF3826
Other DBs
NCBI-ProteinID: ABJ72631
UniProt: Q02ZJ1
Position
complement(1036757..1037881)
AA seq 374 aa
MATYQKRGKTWQYSISRTKQGLPRLTKGGFSTKSDAQAEAMDIESKLKKGFIVDPIKQEI
SEYFKDWMELYKKNAIDEMTYKGYEQTLKYLKTYMPNVLISEITASSYQRALNKFAETHA
KASTKGFHTRVRASIQPLIEEGRLQKDFTTRAVVKGNGNDKAEQDKFVNFDEYKQLVDYF
RNRLNPNYSSPTMLFIISITGMRASEAFGLVWDDIDFNNNTIKCRRTWNYRNKVGGFKKP
KTDAGIRDIVIDDESMQLLKDFREQQKTLFESLGIKPIHDFVCYHPYRKIITLSALQNTL
EHALKKLNISTPLTVHGLRHTHASVLLYHGVDIMTVSKRLGHASVAITQQTYIHIIKELE
NKDKDKIIELLMEL
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggctacatatcaaaagcgtggaaaaacttggcagtattcaatatcaagaacaaaacaa
ggacttcctcgtctaacaaaaggtggtttttctacaaagtccgatgcacaagctgaagca
atggatattgaaagcaaactaaaaaaaggatttattgttgaccccattaagcaagaaatt
tccgaatattttaaagactggatggaactttataagaaaaatgcaattgatgaaatgact
tataaaggttatgagcaaacgttaaaatatttaaaaacctatatgccaaatgttttaatt
tccgaaataacagcatcttcttatcaaagagcgctaaataaatttgctgaaacacacgcc
aaagcatctacaaaagggtttcatactagagttagagcatctattcaaccactcattgaa
gagggacgactgcaaaaagattttaccactcgtgcagtagttaaaggtaatggaaatgat
aaagccgagcaagacaagtttgtaaattttgatgaatacaagcaattagttgattatttc
agaaataggcttaatccaaactattcatctcccactatgctgtttataatttcaattact
ggcatgagagccagtgaagcttttggattagtctgggatgatattgattttaataataac
actatcaagtgtcgcagaacttggaattacagaaataaagtaggtggtttcaaaaagccc
aaaacagatgctggaataagagatattgttatagatgatgaaagtatgcaattgctaaaa
gattttagagaacagcaaaaaacattatttgaaagtttgggtataaaaccgatacatgac
ttcgtttgttatcatccttatagaaaaataataactctctcagctttgcaaaatacatta
gaacatgcattaaaaaaactaaatatttctactccacttactgtacacggtttaaggcat
actcatgcttctgttctcctctatcatggagttgatatcatgactgtttcaaaacgccta
ggacatgcaagtgtggctatcacacagcaaacctatatccatattataaaagagctagaa
aataaagataaggataaaataattgagctactaatggagttataa

DBGET integrated database retrieval system