KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_0049Help
Entry
LACR_0049         CDS       T00420                                 

Definition
(GenBank) acetoin/pyruvate dehydrogenase complex, E2 component, dihydrolipoamide succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
llc00010  Glycolysis / Gluconeogenesis
llc00020  Citrate cycle (TCA cycle)
llc00620  Pyruvate metabolism
llc01100  Metabolic pathways
llc01110  Biosynthesis of secondary metabolites
llc01120  Microbial metabolism in diverse environments
llc01130  Biosynthesis of antibiotics
llc01200  Carbon metabolism
Module
llc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:llc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LACR_0049
   00020 Citrate cycle (TCA cycle)
    LACR_0049
   00620 Pyruvate metabolism
    LACR_0049
Enzymes [BR:llc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LACR_0049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 RnfC_N E3_binding GCV_H ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: ABJ71677
UniProt: Q033E5
Position
complement(44864..46450)
Genome map
AA seq 528 aa AA seqDB search
MTEIFKMPDIGEGMHEGDIANWLVKVGDVVKEDDPIAEVQNDKLMQEILSPYSGTVTKLF
VEEGTTVEVDSPLVEFDGDGSGTSAAAPSAQETASSDAPSGNAQIFTMPDIGEGMHEGDI
ANWLVKVGDEIKEDDPVAEVQNDKLMQEILSPYSGKVTKLFVEAGTTVEVGAPLIEYNGN
GESSSNPAPAASPAPIAEAPKTAAAPTDAPLTKTTSTGHILAMPSVRHYARKAGIDLTQV
PATGRHGHTTLADVKAFESGSVAPIAPVAPESAPVAPAPKADKATEKAPTVKSVAGDRRE
AMNPTRKVVSKVMTAQHTHIPPVTNFDQVEVSKLVKHRAVFKEVAAKQDIKLTYLAYVAK
ALATTAHKFPEINASVDYDKQEIVYHEHVNLGIAVNAPTGLYVPVIHEAETKSILEIAKE
IAELATATREGTLKPQQMQGSTITISNIGSARGSWFTPIINGSDVVILGLGSIVKEPIVN
GEGEIVVGQNMKLSMTYDHRLIDGMLGQTSLNYLKSLLADPEFMLMEI
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatttttaaaatgcctgatattggcgaaggaatgcacgaaggggacattgcc
aactggttagttaaagttggagatgttgttaaagaagatgatccaattgctgaagtacaa
aatgataaactcatgcaagaaattctctctccctactctgggactgtaacaaaactcttc
gttgaagaaggaacaactgtagaagttgattctcctttggttgagtttgatggagacggt
tcaggaacttctgcagctgctccttccgctcaagaaacagcaagttctgatgctccttct
ggcaatgctcaaatcttcaccatgcctgatattggtgaaggaatgcatgaaggcgatatt
gccaactggctcgttaaagttggagatgaaattaaagaagatgatcctgttgcagaagtt
caaaacgataaactcatgcaagagattctttctccttactctggaaaagtcacaaaactt
ttcgtcgaagcaggaacaactgtagaagttggtgctcctttgattgaatacaatggaaat
ggtgaatcttcaagtaatcctgctcctgctgctagtcctgcgccaattgcggaagctcct
aaaacagccgctgcacctactgatgcgccattgacaaaaacaacttctactggacatatt
cttgctatgccatctgtccgtcattatgctcgtaaagcgggaattgatttgactcaagta
cctgcaactggtcgtcatgggcatacaactttggctgacgttaaagcttttgaatctggt
agcgttgcaccaattgctcctgtggctccagaatcagctcctgtggcacctgcgcctaaa
gctgataaagctacggaaaaagccccaactgttaaatctgtggctggagatcgtcgtgaa
gcaatgaatccaactcgtaaagttgtttctaaagttatgactgctcaacacactcatatt
ccaccagtaacaaactttgatcaagtggaagtttctaaacttgttaaacatcgcgccgtc
ttcaaagaagtagcagcaaaacaagatatcaaattgacttaccttgcttatgttgctaaa
gccttggcaactactgctcataagttcccagaaattaatgcttctgttgactatgataag
caagaaattgtttatcatgaacatgtcaacctcgggattgctgtaaatgccccaactggt
ttatatgtcccagtcattcatgaagctgaaactaaatcaatccttgaaattgcaaaagaa
attgctgaattagcgactgctacacgtgaaggaacgcttaaacctcaacaaatgcaaggc
tcaacgattacaatttcaaatattggttctgctcgtggttcttggtttacaccaatcatc
aacggttctgatgttgtgattttaggtttgggttcaattgttaaagaaccaattgtcaat
ggtgaaggtgaaattgtcgtaggacaaaacatgaaattgtctatgacttatgaccaccgt
ttgattgatggtatgttgggtcaaacatcacttaactacttgaaatcacttttggctgac
cctgagttcatgcttatggaaatttaa

DBGET integrated database retrieval system