KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_0145Help
Entry
LACR_0145         CDS       T00420                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
llc00500  Starch and sucrose metabolism
llc01100  Metabolic pathways
llc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LACR_0145
Enzymes [BR:llc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     LACR_0145
Exosome [BR:llc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LACR_0145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase Alpha-amylase_C Cellulase AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ABJ71766
UniProt: Q032V6
Position
complement(128316..130259)
Genome map
AA seq 647 aa AA seqDB search
MPLNILDYDPYLEPFKDDLSLRLFEFARTKKRILDVDGSLVDFANGYKYFGFQQESKHWT
FREWAPNAKKAWLVGDFNNWENNYELKQAYGGTWEISVPGLLPVGSKVKIKLLLPTGEVV
YRVPSYIMYALPNENHGLDGVITQPKYEWKNKSPKLSEAPLIYEAHIGISTEEYKINSYK
EFTRDVLPRIKKDGYNTIQLMAIMEHPLYASFGYQVSNFFAISSRFGQPEDLMELIDKAH
GLGLQVLLDVVHSHAVKNIEDGLNYFDGTENQYFHEGERGNHPAWKTKLFNYGKDEVLHF
LLSNLKFWLDIYHFDGFRFDGVTSMLYHDHGLGTAFTDYSKYFSLNTDVEAVTYLMLANE
LTHLFNPSATTIAEDMSAMPGMALPISAGGIGFDYRLSMGIPDFWIKQLKEKTDNSLDLL
SLWWELTTRRPGEKNIGYSESHDQALVGDKTLMMWLANEEIYWNMDINSQSLIIDRAIAL
HKLIRLITFSLAGEGYLNFMGNEFGHPEWLDFPREENHDDFQHARRQWSLADNENLRFKY
LLAFDQAMLNLEHDFKFLESTDPVQQLWIKDSDKLLAYKKGQLVFVFNFHPSYEQKLQLQ
FSKKPELIFDSDDQKFGGFGPRSSFGWSKGTLNLILEPRTAMVFKIK
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaatatcttggattatgacccctatttagaacctttcaaagatgacttgtct
ttacgcctctttgaatttgctagaactaagaaacggattttggacgttgatggttcttta
gttgattttgctaacggctataagtattttggcttccaacaagaaagtaaacactggact
ttccgcgaatgggcaccaaatgctaaaaaagcttggcttgttggtgactttaacaattgg
gaaaacaactatgaactaaaacaggcttatggcgggacttgggaaatttcagttcctgga
ttattacctgtaggttctaaagtaaaaataaagttgcttttgccaactggagaagttgtt
tatcgtgttccttcttacattatgtatgctcttcctaatgaaaatcatggtttagacggg
gttattactcagcctaagtacgaatggaaaaataaaagccctaaactaagcgaagcacct
ttgatttatgaggcacatattgggatttcaaccgaagaatacaaaattaattcttacaaa
gaattcacgcgcgatgttttacccagaattaaaaaagatggttacaataccattcagctg
atggcaattatggaacacccgctctatgctagttttggttatcaagtttccaattttttt
gccatctctagtcgctttggtcagccagaagatttaatggaattgattgataaggcacat
ggtttgggtttgcaagtgcttttagacgtggttcattcacatgctgtaaaaaatattgag
gatgggctcaactattttgatggaacagaaaatcagtattttcatgaaggcgaacgggga
aatcatccagcttggaagacgaaactttttaattatggcaaagatgaagtccttcatttt
ttactatcaaatctaaaattttggctagacatttatcatttcgatggctttcgttttgat
ggagtaacttcaatgctttatcatgaccatggtttaggaactgcttttacagattatagt
aagtatttttcacttaatacggatgttgaagccgtgacatatttgatgctggctaatgaa
ctaactcatctctttaatccatcagcaacaacaatcgctgaagacatgtctgccatgcct
gggatggcactacctatctcggctggcggaattggttttgattatcgtttgtcaatggga
attcctgatttttggattaaacaattgaaagaaaaaacagataatagtttagatttgcta
agtttatggtgggaattgacgaccagacgacctggagaaaaaaatatcggttattcagaa
agtcatgatcaagctttagttggagataaaacactgatgatgtggctagctaatgaagaa
atctattggaacatggacatcaatagtcaatctctgattattgaccgtgccattgccctc
cataagttaattcgattgattactttcagtctagcaggtgaaggttatttaaatttcatg
ggaaacgaatttggtcatcctgaatggctcgatttccctcgagaagaaaatcatgatgat
tttcaacatgctagaagacaatggtcacttgctgataacgaaaatttacgtttcaaatat
ttactggcatttgaccaagccatgctcaatttagaacatgatttcaaatttttagaaagt
acagatcctgttcaacagctttggattaaggattcggataaattactggcatacaaaaaa
ggacaattagtttttgtctttaatttccaccctagttatgagcaaaaacttcagctccaa
ttttctaaaaaaccagaacttatctttgacagtgatgatcaaaaattcggaggatttggt
ccccgaagtagttttggttggtcaaaaggaactttaaatttgattcttgaacctagaaca
gcgatggtgtttaaaattaaatag

DBGET integrated database retrieval system