KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_0171Help
Entry
LACR_0171         CDS       T00420                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
llc00970  Aminoacyl-tRNA biosynthesis
llc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LACR_0171
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:llc03029]
    LACR_0171
Enzymes [BR:llc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LACR_0171
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LACR_0171
Mitochondrial biogenesis [BR:llc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LACR_0171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ABJ71790
UniProt: Q032T2
Position
156702..158135
Genome map
AA seq 477 aa AA seqDB search
MNFETVIGLEVHVELSTNSKIFSPASTKFGGDPNSNTNVIDWSLPGVLPVMNKGVIDSGI
KAALALNMDIHKSMHFDRKNYFYPDNPKAYQISQFDEPIGYNGSIEIELEDGHKATIRIE
RAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRTPEEAYAYLTALKEAILYTG
ISDVKMEEGSMRCDANVSLRPYGQEAFGVKTEVKNMNSFSNVKKALDFEVARQAKILRAG
GEIRQETRRFNDKTGETILMRVKEGASDYRYFPEPDVPRFEISDEWIEQMRESLPMTATA
RRAHYINDLGLSDYDARQLTATKEVSDFFDQAIKFDTDPKLVSNWLQGEVAQYLNSEKKE
LHEIGLTPENLTEMIRLISDGTISSKIAKKVFIELAKNGGSAEEFVKKAGLVQISDPDLL
LPIIHEVFAKNEQSVADYRGGKQNAAKALVGQLMKATKGQANPTVAQKLLYQELDNF
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaaacagtaattgggcttgaagtccacgttgagttaagtacaaactcaaaa
attttcagtcccgcctctacaaaatttggtggcgaccctaacagcaatacaaatgtgatt
gactggtcacttcctggtgttttaccagtcatgaataaaggtgtgattgatagcgggatt
aaagcggctcttgctttgaatatggatattcacaaatcaatgcactttgaccgcaaaaat
tatttctatcctgataatcccaaagcttaccaaatttcacaatttgatgagccaattggt
tacaatggttcaatcgagattgaacttgaagatggtcataaagcaacgattcgtattgag
cgtgctcacttggaagaagatgctgggaaaaatactcacggaacagatggttactcttat
gttgacttgaatcgtcaaggtgtgccattgattgagattgtttcagaagctgatatgcgc
actccagaagaagcttatgcttatttgacagcgctcaaagaagctattctttacacagga
atttctgatgtgaagatggaagaaggttcaatgcgttgtgacgccaatgtttcgcttcgt
ccttatgggcaagaagctttcggtgtgaagacagaagttaaaaatatgaactcttttagc
aatgtcaaaaaagctttggactttgaagtggcacgtcaagctaaaattttgcgtgcgggt
ggcgaaatccgtcaagaaacgcgtcgttttaatgacaaaaccggtgaaacaattttgatg
cgtgtcaaagaaggggcgtctgattatcgttacttcccagagccagatgttcctcgtttt
gagatttctgacgaatggattgaacaaatgcgcgagagccttccaatgacagcaactgca
agacgtgcacattatattaatgatttgggcttatctgactatgatgcgcgtcaattgacc
gcaactaaagaagtttcagatttctttgatcaagcgattaaatttgatactgaccctaaa
ttggtttcaaactggttgcaaggcgaggtcgctcaatatttgaatagcgagaaaaaagaa
cttcatgagattggattgaccccagaaaatctgacagagatgattcgtttgatttcagat
ggaacaatttcttcaaaaattgctaaaaaagtctttattgaattagcgaaaaatggtggt
tctgcagaagaatttgtcaagaaagctggtttggtccaaatttctgatcctgaccttctt
ttgccaatcattcatgaggtctttgctaagaatgaacaatctgtggccgattatcgcggt
gggaaacaaaatgcagccaaagctttggttggtcaattgatgaaagcaactaaagggcaa
gctaatccaacagtcgctcaaaaacttttgtatcaagaattagataatttttaa

DBGET integrated database retrieval system