KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_0172Help
Entry
LACR_0172         CDS       T00420                                 

Definition
(GenBank) Amidase family enzyme
  KO
K01426  amidase [EC:3.5.1.4]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
llc00330  Arginine and proline metabolism
llc00360  Phenylalanine metabolism
llc00380  Tryptophan metabolism
llc00627  Aminobenzoate degradation
llc00643  Styrene degradation
llc01100  Metabolic pathways
llc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:llc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    LACR_0172
   00360 Phenylalanine metabolism
    LACR_0172
   00380 Tryptophan metabolism
    LACR_0172
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LACR_0172
   00643 Styrene degradation
    LACR_0172
Enzymes [BR:llc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     LACR_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase DUF4406 SPT_ssu-like
Motif
Other DBs
NCBI-ProteinID: ABJ71791
UniProt: Q032T1
Position
158259..159758
Genome map
AA seq 499 aa AA seqDB search
MLEIKDATYWAEQLKSRNLSAKELLEMTKQKIDQLNPLYNAIVAEDLAVAKEDLALTGQG
FFAGLPFALKMLGQTHKGLPDTASSQLFSENVASEDDNYVKALIRAGLTPYGQTNSPEFG
FKNISDSKLYGDTRNVWNSDYYSGGSSGGAASAVASGMFAIAGASDGGGSIRIPASFSGL
IGLKMTRGRMLQGPGSYRGWQGASISGALTVSVRDTARFILEMQTLQEAAPYQARLLDEK
ELLEVCESTDSFVSKNLSVKLKIAYSLQSPISGIELSDDALKAVKKAVEFLKGQGHELVE
IDFPLNARPLIQSYYQMNAAETVAMLEPWEKSAGRQLTSQDVELLTYALLEAGRKAPVTT
YINALAQWDQAAETFADKIYADYDLFLTPTTAKTAPKIGEELMTEEILTKMSEISQYDFE
QQIAIIEAAFERSLAFTPYNFISNLTGQPALSLPIYVNKETNLPLGIQLWGPKNSEIELL
KVAKEFENADQFILPKFYQ
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaattaaagatgcaacttattgggcggagcaattgaaatcaaggaatctttct
gccaaagaattattagaaatgacaaagcaaaaaattgaccagctcaatccactctacaat
gcgattgtggcagaggatttagcggtcgcaaaagaagatttagctttgacaggtcaaggt
ttttttgcaggactgccatttgcgttgaaaatgttggggcaaacgcataaaggattgcct
gatacagctagctctcagctcttttcagagaatgtggcatctgaggatgataattatgtt
aaagcgctgataagggcaggattgacgccttatgggcagacgaattcgccagagtttggt
tttaaaaatatttcggattcaaaactctacggtgatacacgaaatgtttggaattctgat
tattattcgggtgggtcatctggtggtgcggcttcagccgtggcttctgggatgtttgcg
attgctggagcttctgatggcggagggtcaattcggattccagcctcattttcaggtttg
attggtctaaagatgacgcgtggacgaatgctacaagggccgggctcttatcgaggttgg
caaggtgcatctatttcaggggcattaacagtatcggtgcgagatacggcaagatttatt
ttggaaatgcaaactttgcaagaggcagcgccttatcaggctcgcttgttagatgaaaaa
gaacttttagaagtctgtgaatctactgacagttttgtcagtaaaaatttgtcagtaaaa
ttaaaaattgcttattctttgcaaagtccgatttctggaattgaactttctgatgatgct
ctaaaagcggtcaaaaaagctgttgaattcttaaaaggacagggacatgaacttgtggaa
attgattttccattgaatgcccgtcctttaattcaatcttattatcagatgaatgcagcg
gaaacggtggctatgcttgaaccttgggaaaaatcagcgggtcgccaattgacaagtcaa
gatgttgaacttttgacttatgcccttttagaagctggacgaaaagcgcccgtcactact
tatattaatgctttggctcaatgggatcaggcagccgaaacctttgctgacaagatttat
gctgattatgatttatttttgaccccaactacggcaaaaacagcgcctaaaattggtgaa
gaattaatgacagaggaaatattgaccaaaatgtcagaaatcagtcaatatgattttgaa
caacaaatagcaattattgaggcggcttttgagcgttcattggcctttacaccctataat
ttcatcagtaatttgacgggacaaccagctctttcactaccgatttatgtcaataaagaa
acaaatcttccattggggattcaactctggggacctaaaaattctgaaattgaattacta
aaagtagctaaagaatttgaaaatgctgatcagtttattttgccaaaattctatcagtaa

DBGET integrated database retrieval system