KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_0249Help
Entry
LACR_0249         CDS       T00420                                 

Definition
(GenBank) Predicted hydrolase (HAD superfamily)
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
llc00361  Chlorocyclohexane and chlorobenzene degradation
llc00625  Chloroalkane and chloroalkene degradation
llc01100  Metabolic pathways
llc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:llc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LACR_0249
   00361 Chlorocyclohexane and chlorobenzene degradation
    LACR_0249
Enzymes [BR:llc01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     LACR_0249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6 5_nucleotid
Motif
Other DBs
NCBI-ProteinID: ABJ71867
UniProt: Q032K5
Position
230831..231505
Genome map
AA seq 224 aa AA seqDB search
MTGKYPILVFDINETLLSFESLESFFAKYFDDKKVLRQWFSEQILYSQALTLSRNYYDFG
ELATSVLQMVAELHNHSLNDRVLLEFKQLLGQLLPYPEVEKGLEMLKQSGFRMIALTNSP
TLSSQVSLERSGLRKYFENVISVEEVQQYKPAPATYRRVRELIGFEEKYCMIACHIWDLL
GAQSENFDTAFIKRQGNATLPNLFQDNFVADDLQELSKLLIKKY
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgacaggaaaataccctattcttgtttttgatatcaatgaaaccttgctaagtttcgaa
agtttagaaagttttttcgctaaatattttgatgataaaaaagtactacgtcagtggttt
tctgaacaaattttatacagtcaggctctaaccttgagtaggaactactatgattttgga
gaacttgcgacatcagttttgcaaatggttgctgaactccataatcattctttaaatgat
agagttttgttagagttcaaacagttgcttggacagctcctgccttatccagaggtagaa
aaaggacttgaaatgttgaaacaatcaggttttcgtatgattgctttgactaattcacct
acgcttagcagtcaggtttcgcttgaacgctctggcctacgtaagtattttgaaaatgtc
atctctgtggaagaagttcagcagtataaaccagccccagccacttatagacgagttcgt
gagttaattggatttgaggaaaaatattgcatgattgcttgtcatatttgggatttatta
ggcgctcaaagtgaaaactttgataccgcttttatcaaacgacaaggcaatgcgactttg
cccaatctatttcaagataattttgtagctgatgatttacaagaattatcaaaattgcta
ataaaaaaatattaa

DBGET integrated database retrieval system