KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_0335
Entry
LACR_0335         CDS       T00420                                 

Definition
(GenBank) ABC-type phosphate/phosphonate transport system, ATPase component
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
llc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:llc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LACR_0335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:llc02000]
    LACR_0335
Enzymes [BR:llc01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     LACR_0335
Transporters [BR:llc02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    LACR_0335
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_29 AAA_16 AAA_22 MMR_HSR1 AAA_23 AAA_18 AAA_25 AAA_15 AAA_28
Other DBs
NCBI-ProteinID: ABJ71942
UniProt: Q032D0
Position
302851..303591
AA seq 246 aa
MIKFENVSKVYPNGTKGLTDVNLQIDQGEFVAIIGTSGAGKSTLIRCVNGLNDVTSGRLF
VNDTDVSKLKGKDLRKFRRHVGMIFQSYNLVPRVTVLKNVMFARVPEMNLFKVIFGLFSK
EDKLVALDSLNKVGILDKAYIRADQLSGGQQQRVSLARALTQESEILLADEPVSALDPVT
AKEVMDDFKRINEELNKTILLNIHHVELALEYASRIIAVKKGKIVYDGPSQEVTKEILDE
VYRKEG
NT seq 741 nt   +upstreamnt  +downstreamnt
atgattaaatttgaaaatgtgtcaaaagtttacccaaatggcacaaaaggtctgacagat
gttaacttacaaattgaccaaggagaatttgtagccattattgggacatcaggagcgggg
aaatccacccttattcgctgtgtcaatggtttaaatgatgtgacttccggtcgtctcttt
gtgaatgatacggatgtctcaaaactaaaaggcaaagacttaagaaaatttcgacgccac
gtcggaatgatttttcaatcctataatttagtgcctagagttactgttttaaaaaatgtt
atgtttgctcgtgtcccagagatgaacttatttaaagtgatttttggcttattttcaaaa
gaagataaacttgttgctttagattctctgaataaagtaggaattttagacaaggcatat
atccgggctgatcaactttctggtggtcaacaacaaagggtttcacttgcgcgtgcactg
acacaagaaagtgaaattttactggctgacgagcctgtttcagcccttgacccagtgacg
gctaaagaagtaatggatgattttaaaagaattaacgaagagctcaataaaacgatttta
ctaaatattcaccatgttgaacttgccttagaatatgcctcacgaattatcgccgtcaaa
aaaggaaagattgtctatgatgggccctcacaagaagtaaccaaagaaattttagatgaa
gtttatagaaaagagggctaa

DBGET integrated database retrieval system