KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1007Help
Entry
LACR_1007         CDS       T00420                                 

Definition
(GenBank) Formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
llc00670  One carbon pool by folate
llc01100  Metabolic pathways
llc01120  Microbial metabolism in diverse environments
llc01200  Carbon metabolism
Module
llc_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:llc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LACR_1007
Enzymes [BR:llc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     LACR_1007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: ABJ72545
UniProt: Q02ZS7
Position
947150..948817
Genome map
AA seq 555 aa AA seqDB search
MKTDIEIAQAAEIQPITKIAEKIGLSFDDIELYGKYKAKIPLEVLEKFDEQTDGKLVLVT
SINPTPAGEGKSTVTVGLADAFARQDKNVMVALREPSLGPVMGIKGGAAGGGFAQVLPME
DINLHFTGDIHAITTANNAISAFLDNSLHQGNPLNIDPRRIIWKRVLDLNDRALRHVTIG
LGGPLNGVPREDGFDITVASEIMAVLCLATSISDLKERLARIVIAQNYDRKPVSVGDLGV
QGAIAMLLKDALKPNLVQTIEGTPALIHGGPFANIAHGCNSVLATKTALKLADIVITEAG
FGADLGGEKFLDIKTRQLGKQPDAVVVVATLRALKMHGGVDKKELTSENVEAVKKGFANL
ERHIKNMQSYGLPVIVAINQFASDTESEISTLKELTEALGVSVSLTQVFAKGGEGGLDLA
EKLSAMLQAKPDFRYLYELNQPLSVKLDKVVTEIYGGSKVNLSPKAKRQMREIEENGWNN
LPVCMAKTQYSFSDQANLLAAPEGFEVTVRELIPKIGAGFIVALLGDVMTMPGLPKNPAA
LKMDVTDDGKISGLF
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagatattgaaattgcccaagctgctgaaattcaaccaattactaaaattgcc
gaaaaaataggattatcttttgacgatattgaactttacgggaaatataaggctaaaatt
cccttagaagtgttagaaaagtttgatgaacaaaccgatgggaaattggttttagtaaca
tctattaaccctacaccagcgggtgagggtaaatcgacggtgacagtggggcttgctgat
gcctttgccagacaagataaaaatgtaatggttgctctacgagagccttctcttggtccg
gtcatgggaattaaaggtggagcagctggtggtggatttgctcaagttcttccaatggaa
gacattaatcttcattttacaggagatattcatgccattacaacggctaataacgcaatt
tcggcttttctggacaattcgcttcatcaagggaatcctttaaatattgacccacgaaga
attatctggaaacgtgtgcttgatttgaacgaccgtgctttacgtcatgtaacgattgga
ctgggaggaccgcttaatggggttcctcgtgaggatggttttgatattacagtggctagc
gaaattatggctgttctttgtctggcgacttctatcagtgatttgaaagagcgtttagca
agaattgtcatcgctcaaaattatgaccgtaaacctgtcagtgtcggagatttaggggtt
cagggggcaattgcaatgctcttaaaagatgcccttaaaccaaaccttgttcaaacaatt
gaaggaacaccagctttaattcacggtggaccttttgctaatattgcccatggatgtaat
tctgttttagcaacaaaaacagcacttaaattggctgatattgtcattacagaggcagga
tttggagctgaccttggtggtgaaaaatttttggatatcaagacacgtcagttagggaaa
caacctgatgctgtggtagttgtggctacgcttcgtgcgcttaagatgcacggtggcgtt
gataagaaagaattgacaagtgaaaatgtcgaggctgttaaaaaaggttttgctaatttg
gaacggcatatcaaaaacatgcaaagttatggcctgccagtgattgtagcgattaatcaa
tttgcatcggatacagagtcagaaatttcaactttaaaagaactgacagaagctttggga
gtttcagtttcactaactcaagtttttgctaaaggtggcgaaggtggtttagatttagct
gaaaaactgtcagcaatgttacaagcaaaacctgattttcgttatctttatgagctaaat
caacccttgtcagtaaaacttgacaaagttgtgacagaaatttatggcggttccaaagtt
aatttatctccgaaagctaagcgtcagatgagagaaattgaagaaaatggttggaataac
ttaccagtttgtatggctaaaacgcagtattcattttcagaccaagcgaatcttttagca
gctcccgaaggctttgaggttacagtgcgtgagctgattccgaaaatcggtgctggattt
attgttgctcttttaggagatgtgatgacaatgccaggtctgcccaaaaatcctgctgct
ttaaaaatggacgtgactgatgatggtaaaatctcaggattattttag

DBGET integrated database retrieval system