KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1033Help
Entry
LACR_1033         CDS       T00420                                 

Definition
(GenBank) PTS system D-fructose-specific IIC component (F1P-forming), Frc family / PTS system D-fructose-specific IIB component (F1P-forming), Frc family / PTS system D-fructose-specific IIA component (F1P-forming), Frc family
  KO
K02768  PTS system, fructose-specific IIA component [EC:2.7.1.202]
K02769  PTS system, fructose-specific IIB component [EC:2.7.1.202]
K02770  PTS system, fructose-specific IIC component
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
llc00051  Fructose and mannose metabolism
llc01100  Metabolic pathways
llc01120  Microbial metabolism in diverse environments
llc02060  Phosphotransferase system (PTS)
Module
llc_M00273  PTS system, fructose-specific II component
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LACR_1033
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    LACR_1033
Enzymes [BR:llc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     LACR_1033
Transporters [BR:llc02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component [MD:M00273]
    LACR_1033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_2 PTS_EIIC PTS_IIB
Motif
Other DBs
NCBI-ProteinID: ABJ72571
UniProt: Q02ZQ1
Position
974572..976476
Genome map
AA seq 634 aa AA seqDB search
MEIKDLLKTEVMILDLQATSKEAVIDEMVNKLVSEGYVSDFATFKAGIMAREAQTSTGLG
DGIAMPHSKNTAVNEPVVLFAKSKTGVDYAALDGQPVNLFFMIAAPDGANDTHLEALAQL
STYLLKDGFQDRLRKVEYPREVIQLFSEKQEEVATLENAEHYIVAVTACTTGIAHTYMAE
EALKKQALEMGVGIKVETNGARGIDNKLTSADIQKADAVIVAADKKVEMNRFAGKEMVQV
PVAHAIRDTEELINRALSGNAPIYEADGTDEVKEESSGGLGKAFYKHLMGGVSAMLPFVV
GGGILIALAFLIDQAMGVPQSQLANLGVYHPLAAYFKNVGGAAFAFMLPVLAGFIANSIA
DKPGLVAGFVAGSMASSGLAFGHLDPAKMIPSGFLGALVGGFLAGGVIIILRKVFAKLPR
SLDGIKAILIYPLVGTFITGFLMLFVNIPMAAINTGISNFLASLSGASALVLGLVVGGMM
AIDLGGPINKAAYIFATGTLAATVSTGGSVTMAAVMAGGMVPPLATTVAVILFKNKFTKE
ERNSGLTNIVMGLSFITEGSIPFGAADPARAIPSFMIGAAVAGGLTGMANIKLMAPHGGV
FVLALTNNPLLYLLFILIGAIVSGLLFGALKKAK
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaagatttattaaaaacagaggttatgattcttgacctccaagcaactagc
aaagaagctgttattgatgaaatggtcaataaattagtttctgaaggttatgtcagtgat
tttgcaacttttaaagcaggaattatggcacgtgaagcgcaaacttcaactggacttggt
gacgggattgccatgcctcacagtaaaaataccgctgttaatgaaccggttgttctattt
gcaaaatcaaaaactggtgttgattacgcggcattagatggtcaacctgtcaatcttttc
tttatgattgcagccccagatggtgctaatgatactcacttagaagctttggcacaactt
tccacttatcttcttaaagacggtttccaagaccgtttgagaaaagttgaatacccacgc
gaagtcattcaactcttttctgaaaaacaagaagaagttgcaactctagaaaatgctgaa
cattacattgtagctgtaacagcatgtacaacaggaattgcccatacttacatggctgaa
gaagcacttaaaaaacaagccttggaaatgggtgttggtataaaggttgaaaccaatggt
gcgcgtggaattgataataaattaacttcagctgatattcaaaaagctgatgctgttatc
gtagctgcggacaaaaaagtcgaaatgaatcgttttgctggtaaagaaatggttcaagtt
ccagttgcacacgccattcgagatacggaagaattaattaatcgtgcactttcaggaaat
gcaccaatctatgaagcagatggaacggatgaagtaaaagaagaatcatctggtggctta
ggtaaagctttctataaacacttaatgggtggtgtttctgcaatgcttccattcgttgtc
ggaggtgggattcttatcgctcttgctttcttgattgaccaagcgatgggagttcctcaa
agtcaattggccaaccttggagtttatcatcctttagctgcttactttaaaaatgttggg
ggcgcggcttttgcctttatgttacctgttttagccggtttcattgcaaactcaatcgct
gataagcctggtttagttgctggttttgtcgctggttcgatggcatcatctggtttggcc
tttggtcatttagaccctgctaaaatgattccgtcaggtttcttaggcgccttggttggt
ggtttccttgccggtggagtaattattattcttcgtaaagtcttcgcaaaacttccacgt
tcacttgatgggattaaagctatcttgatttatccattagttggaacatttatcacaggt
ttcctaatgctctttgtcaatatcccaatggctgcaattaataccggaatttctaacttt
ttagcaagcttatcaggagcatctgcccttgttcttggtctagttgttggtggaatgatg
gctattgaccttggtggtccaatcaacaaagctgcttatatctttgcaactggtacttta
gcagcaacagtttcaactggtggttcagtaacaatggcagcagttatggctggtgggatg
gttccaccactcgcaactacagtagctgttatcttgttcaaaaataaatttaccaaagaa
gaacgtaattctggtttgacaaacattgtgatggggctttcattcatcactgaagggtca
attccatttggcgcagccgacccagcacgcgcaattccatcatttatgattggagcagca
gtagccggtggtttgactggtatggccaatattaaattgatggcaccacatggtggagtc
ttcgtacttgctttgactaataacccgttactttatctcttgttcatcttgattggagca
attgtttcaggcctattatttggagctttgaaaaaagctaaataa

DBGET integrated database retrieval system