KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1374Help
Entry
LACR_1374         CDS       T00420                                 

Definition
(GenBank) D-alanine-activating enzyme
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
llc00473  D-Alanine metabolism
llc01100  Metabolic pathways
llc01503  Cationic antimicrobial peptide (CAMP) resistance
llc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:llc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LACR_1374
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LACR_1374
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    LACR_1374
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:llc01504]
    LACR_1374
Enzymes [BR:llc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     LACR_1374
Antimicrobial resistance genes [BR:llc01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    LACR_1374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABJ72895
UniProt: Q02YS7
Position
complement(1286322..1287821)
Genome map
AA seq 499 aa AA seqDB search
MKLLEQIFEIANKNPDLIVLAECEQKFTYRQLFVAVSEISKQIKERTLVNRPILIFGKND
FISLAAMLAANLTGHAYISVDAHTPFERTEMINSAAKPAVVITTVNLSEDFSALFTDRIS
VNLNTLSLDEKLPELDFSQAVSGNDSNYIIYTSGTTGVPKGVEVSHANLVTFTNWMNNDF
NKIENNQILSQALYSFDLSIFSLYPSLTTGGTLVSLSRDETTNFKLLFERLNSTVINTWI
STPSFVDICLLDPSFTEKEHPNLVQFIFCGEELTKKTAEKLLTAFPSATIYNTYGPTEAT
GAISSIKVTEKLLTENDRLPIGFAKPGVELKIMDGEIIIIGDSVAKGYFENPEKTAQAFF
AVDGKPAYHTGDAGSLTDEGMLRYQGRIDFQVKFNGFRIELQDIEANIQNLKDIEKAVVL
PKSNDQHKVTALIAYLESEKTFADRAEERAFTKQLKAELSKTIMDYMMPTKFIYLKKFPL
NQNGKVDRKALAQKERGDN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaattattagaacaaatttttgaaattgcaaacaaaaaccctgaccttatcgtgctt
gccgagtgtgagcagaaatttacttaccgccaattattcgtcgctgtatcggagatttca
aaacaaatcaaggagcggacattagtgaatcgtccaatcctaatttttggtaaaaatgac
tttattagtttagcagcaatgctagcagcaaatttgactggacatgcttatatttcagtc
gatgcccacactccatttgagcggacagaaatgattaattcagcagcaaaaccagcagtt
gtgataacgactgttaatctttcagaagatttttctgctctttttactgacagaatctca
gttaatctaaacactctatctctcgatgaaaaacttccagaacttgattttagtcaagcc
gtttctggtaatgatagcaattatattatctatacttcgggaacaactggagtaccaaaa
ggtgttgaagtcagccatgctaatcttgtgaccttcacaaactggatgaacaacgacttt
aacaaaattgaaaataatcaaattttatcacaagccctttatagctttgacttatcaatt
tttagtttgtatccaagcctgacaactggtggaacattagtctcactttcacgtgacgaa
acaacaaactttaaattactttttgaacgattgaattcaacagtcatcaatacttggatt
tctacaccatcatttgttgatatttgcttattggatccctcattcacagagaaagaacat
cctaatttagtacaattcatcttttgtggagaagaattgacgaaaaaaacagctgaaaaa
ttactgacagcattcccgtcagcaactatttataatacttatggtccaacagaagcaaca
ggagctatttcatcaataaaagtgactgaaaaattactgacagaaaatgaccgtcttcct
attggttttgccaaacctggtgtagaactaaaaatcatggatggtgaaatcattattatc
ggtgattccgttgctaaaggttactttgaaaacccagagaaaactgctcaagcctttttc
gcagtagatggaaaacctgcctatcatacaggcgatgccggttcactaactgatgagggc
atgcttcgttatcaaggaagaattgattttcaagtcaaatttaatggattccgtattgaa
cttcaggatattgaagccaatattcaaaacctaaaagatatcgaaaaagcagtggtttta
cctaaatcgaatgaccaacataaagttacagctttaatcgcttatcttgaaagtgaaaaa
acatttgcggatcgtgctgaagaacgagcctttacaaagcaactcaaagcagaactttca
aaaacaattatggattatatgatgccaaccaaatttatttatctcaaaaagttccctctg
aatcaaaatggaaaagttgaccgcaaagcactcgcccaaaaagagcgaggtgacaactag

DBGET integrated database retrieval system