KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1665Help
Entry
LACR_1665         CDS       T00420                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
llc00071  Fatty acid degradation
llc00072  Synthesis and degradation of ketone bodies
llc00280  Valine, leucine and isoleucine degradation
llc00362  Benzoate degradation
llc00380  Tryptophan metabolism
llc00620  Pyruvate metabolism
llc00630  Glyoxylate and dicarboxylate metabolism
llc00640  Propanoate metabolism
llc00650  Butanoate metabolism
llc00900  Terpenoid backbone biosynthesis
llc01100  Metabolic pathways
llc01110  Biosynthesis of secondary metabolites
llc01120  Microbial metabolism in diverse environments
llc01130  Biosynthesis of antibiotics
llc01200  Carbon metabolism
llc01212  Fatty acid metabolism
llc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:llc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LACR_1665
   00630 Glyoxylate and dicarboxylate metabolism
    LACR_1665
   00640 Propanoate metabolism
    LACR_1665
   00650 Butanoate metabolism
    LACR_1665
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LACR_1665
   00072 Synthesis and degradation of ketone bodies
    LACR_1665
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LACR_1665
   00310 Lysine degradation
    LACR_1665
   00380 Tryptophan metabolism
    LACR_1665
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LACR_1665
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LACR_1665
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LACR_1665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:llc04147]
    LACR_1665
Enzymes [BR:llc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LACR_1665
Exosome [BR:llc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LACR_1665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABJ73162
UniProt: Q02Y10
Position
complement(1572717..1573856)
Genome map
AA seq 379 aa AA seqDB search
MKEIVIIDALRTPVGKYDGALAEYSAEKLGTHVVSALLSKNKNIKSDVEQVIFGNVLQAG
NGQNIARQIAINSGLSTSVPASTINEVCGSGMKAVILAKQLLQLGEAEVVIAGGTESMSN
APILKNRKTEEETLSMLSDGLIDAFSGISMGIIGETIAEQFDVSRADQDLFAQNSQEKAV
AASQAGIFNDEIVALGKLSVDETPRPSSSLEKLATLRTAFKENGTVTAGNSSPVNDGASA
LILATKEYAEKHGISYLAELVESAEVGIDPAIMGVSPIDAIQKLVQRSGVQLLEIDLFEI
NEAFAASSIAVNRELGLKDSQVNIYGGAIALGHAIGSSGAKILTTLGYALKREQKRYGIA
SLCIGGGLGLAILLKNPDF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaaattgtaatcattgacgccttaagaacaccagtcggaaaatatgatggtgct
cttgctgagtattcggcagaaaagcttggaacacacgttgtttcagctttattgtcaaaa
aataaaaatataaaatcagatgttgaacaagttatttttggtaatgttcttcaagctggt
aatggtcaaaatattgcgcgccaaattgcgattaatagtggtttatcaaccagtgttcca
gcttcaaccattaatgaagtttgtggttcagggatgaaggcagtaattctagctaagcaa
cttttacagttgggcgaagcagaagttgttattgctggtggaacggaatcaatgtctaat
gcgcctattcttaaaaatcgtaaaactgaagaagaaacattaagcatgttaagtgacggc
ttaattgatgctttttctggcatttcaatgggaattattggagaaacaattgcggagcag
tttgatgttagtcgtgctgaccaagacctattcgcacaaaattctcaagagaaggcagta
gcagccagtcaagcaggaatttttaatgacgagatcgtagctcttgggaaactttctgtt
gatgaaactcctcgaccttcatctagcctagaaaaattggctacattacggacagccttt
aaggaaaatggaacagttacagctgggaattcttcaccagttaatgacggagcttctgct
ttaattttggccactaaagagtatgctgaaaaacatggaatatcttatttagctgaatta
gttgagagtgcggaagttggtattgaccctgcaattatgggagtatcaccgattgatgca
attcaaaaattagttcaacgctcaggcgttcagcttttagaaatagatctttttgaaatt
aatgaggcctttgctgcatcaagtattgctgttaatcgtgaattgggcttaaaagattct
caagttaatatttatggaggagcgattgctcttggacatgctattgggtcaagtggtgcc
aaaatcctgacaactttgggatatgctttgaaacgagaacaaaagcgttatggaattgct
agtctttgtattggcggtggtctagggcttgctattttattgaaaaatcctgacttttaa

DBGET integrated database retrieval system