KEGG   Lactococcus lactis subsp. lactis KLDS 4.0325: P620_01140Help
Entry
P620_01140        CDS       T02882                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
lld  Lactococcus lactis subsp. lactis KLDS 4.0325
Pathway
lld00970  Aminoacyl-tRNA biosynthesis
lld01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lld00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    P620_01140
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lld03029]
    P620_01140
Enzymes [BR:lld01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     P620_01140
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     P620_01140
Mitochondrial biogenesis [BR:lld03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    P620_01140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AGY43510
Position
203903..205336
Genome map
AA seq 477 aa AA seqDB search
MNFETVIGLEVHVELSTNSKIFSPASTKFGGDPNTNTNVIDWSLPGVLPVMNKGVIDSGI
KAALALNMDIHKSMHFDRKNYFYPDNPKAYQISQFDEPIGYNGSIEIELEDGHKATIRIE
RAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRTPEEAYAYLTALKEAILYTG
ISDVKMEEGSMRCDANVSLRPYGQEAFGVKTEVKNMNSFSNVKKALDFEVDRQAKILRAG
GEIRQETRRFNDKTGETILMRVKEGASDYRYFPEPDVPRFEISDEWVEQMRESLPMTAKA
RRAHYINDLALSDYDARQLTATKEVSDFFDQAIKFDTDPKLVSNWLQGEVAQYLNSEKKE
LHEIGLTPENLTEMIRLISDGTISSKIAKKVFIELAKNGGSAEEFVKKAGLVQISDPAVL
LPIIHDVFAKNEQSVADYRGGKQNAAKALVGQLMKATKGQANPTVAQKLLYQELDNF
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaaacagtaattgggcttgaagtccacgttgagttaagtacaaactcaaaa
attttcagtcccgcctcaacaaaatttggtggagaccctaatacaaatacaaatgtgatt
gactggtcacttcctggtgttttaccagtaatgaataaaggggtaattgatagcggaatt
aaagcggctcttgctttgaatatggatattcacaaatcaatgcattttgaccgcaaaaat
tatttctatcctgataatcccaaagcttaccaaatttcacaatttgatgagccaattggt
tacaatggttccattgaaattgaacttgaagatggccataaagcgacgattcgcattgag
cgcgctcatttagaagaagatgctgggaaaaatacgcacggaacggatggttattcttat
gtcgatttgaatcgtcaaggagtaccattgattgagattgtctcagaagctgacatgcgc
actcctgaggaagcttatgcttatctgacagcacttaaagaagccattctttacacagga
atttctgatgtgaagatggaagaaggttcaatgcgttgtgatgccaatgtttcgctccgt
ccttatggtcaagaagcttttggtgtgaagacagaagttaaaaacatgaactcatttagc
aatgtcaaaaaagctttggactttgaagtcgacaggcaagctaagattttgcgcgctggt
ggcgaaattcgtcaagaaacgcgtcgttttaatgacaaaacgggtgaaacaattttgatg
cgtgttaaagaaggcgcttctgattaccgttacttcccagagccagatgtccctcgtttt
gaaatttctgacgaatgggttgagcaaatgcgtgagagccttccaatgacggctaaagca
agacgtgcacattatattaatgatttagctttgtctgattatgatgctcgtcaattgacc
gcaactaaagaagtttctgatttctttgatcaagcgattaaatttgatactgaccctaaa
ttggtgtcaaactggttgcaaggtgaagtggctcaatatttgaatagtgagaaaaaagaa
cttcatgagattggcttgactccagaaaatctgacagaaatgattcgtttgatttcagat
ggaacaatttcttcaaaaattgctaaaaaagtctttattgaattagcaaaaaatggtggt
tctgccgaagaatttgtcaagaaagctggtttggttcaaatttctgaccctgctgtgctt
ttgccaatcattcatgatgtatttgctaagaatgaacaatctgtagcagattatcgtggt
gggaagcaaaatgcggcgaaagctttggttggtcaattaatgaaagcaactaaaggacaa
gctaacccaacggttgcgcaaaaacttttgtatcaagaattggataatttctaa

DBGET integrated database retrieval system