KEGG   Lactococcus lactis subsp. lactis KLDS 4.0325: P620_08565Help
Entry
P620_08565        CDS       T02882                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lld  Lactococcus lactis subsp. lactis KLDS 4.0325
Pathway
lld00071  Fatty acid degradation
lld00072  Synthesis and degradation of ketone bodies
lld00280  Valine, leucine and isoleucine degradation
lld00362  Benzoate degradation
lld00380  Tryptophan metabolism
lld00620  Pyruvate metabolism
lld00630  Glyoxylate and dicarboxylate metabolism
lld00640  Propanoate metabolism
lld00650  Butanoate metabolism
lld00900  Terpenoid backbone biosynthesis
lld01100  Metabolic pathways
lld01110  Biosynthesis of secondary metabolites
lld01120  Microbial metabolism in diverse environments
lld01130  Biosynthesis of antibiotics
lld01200  Carbon metabolism
lld01212  Fatty acid metabolism
lld02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    P620_08565
   00630 Glyoxylate and dicarboxylate metabolism
    P620_08565
   00640 Propanoate metabolism
    P620_08565
   00650 Butanoate metabolism
    P620_08565
  09103 Lipid metabolism
   00071 Fatty acid degradation
    P620_08565
   00072 Synthesis and degradation of ketone bodies
    P620_08565
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    P620_08565
   00310 Lysine degradation
    P620_08565
   00380 Tryptophan metabolism
    P620_08565
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    P620_08565
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    P620_08565
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    P620_08565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lld04147]
    P620_08565
Enzymes [BR:lld01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     P620_08565
Exosome [BR:lld04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   P620_08565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Nab2
Motif
Other DBs
NCBI-ProteinID: AGY44462
UniProt: U5PL28
Position
complement(1681395..1682534)
Genome map
AA seq 379 aa AA seqDB search
MKEIVIIDALRTPVGRYDGALAEYSAAELGTHVVSNLLSKHENIKSDVEQVIFGNVLQAG
NGQNIARQIAIHSGLSNTVPASTINEVCGSGMKAVILAKQLLQLGEAEVVIAGGTESMSN
APIIKNRKTQEETLSMLNDGLVDAFSGISMGIIGETIAEQFDISRADQDAFAQNSQEKAV
AASQAGIFKEEIVAIGEVGVDETPRPSSSLEKLATLRTAFKENGTVTAGNSSPVNDGASA
VILATKDYAEKHGIPYLAEVVDSTEVGIDPAIMGVSPIEAIKKLINRSELELSDIDLFEI
NEAFAASSLAVNRELGLNESQVNIYGGAIALGHAIGSSGSKILTTLSYALKREQKRYGIA
SLCIGGGLGLAVLLKNPNL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaaattgtaatcattgacgccttaagaacaccagttggaagatacgacggtgct
cttgctgaatattcagcagcagaacttgggacacatgttgtttcaaacttattgtcaaaa
catgaaaatataaaatcagatgttgaacaagttatttttgggaatgttcttcaagctggt
aatggtcaaaatatagcacgtcaaattgcgattcatagtggtctatctaatacagtgccc
gcttcaacaatcaacgaagtttgtggttcaggaatgaaagcagtgattttagctaaacaa
cttttacagcttggtgaagcagaagttgtaatcgctggtgggacagaatctatgtctaat
gccccaattataaagaatcgaaaaactcaagaagaaacattaagtatgttaaatgatggc
ttagttgatgccttctcaggaatttctatggggattattggtgaaactattgctgaacaa
tttgatataagtcgagcagaccaagacgcttttgcgcaaaactctcaagaaaaagcggtc
gctgcaagtcaagccggaatttttaaagaagagattgttgcgattggagaagtcggagtc
gacgaaacaccacgtccttcttctagtttagaaaaattagccactttaaggacagctttc
aaagaaaatggaactgtgacagcaggtaattcttctcctgttaatgatggagcttcagct
gtcattcttgcaacgaaagactatgctgaaaaacatgggattccgtacctagcagaagta
gttgatagtacagaagttggaattgaccctgctattatgggagtttcaccaattgaagct
atcaaaaaattaattaatcgttcagagcttgaactttcagatattgacctgtttgaaatt
aatgaagcatttgcagcatcaagtcttgctgtcaatcgtgaacttggtttaaatgaatca
caagttaacatttatggtggtgcaattgcattaggtcatgctatcggttcaagtggttct
aaaattctcacgactttgtcttatgccttaaaacgtgagcaaaaacgctatggaattgct
agtctttgtatcggtggaggcctaggtttggctgttcttttaaaaaatcctaacctttaa

DBGET integrated database retrieval system