KEGG   Lactococcus lactis subsp. lactis KLDS 4.0325: P620_09860Help
Entry
P620_09860        CDS       T02882                                 

Definition
(GenBank) ATP-dependent RecD-like DNA helicase
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lld  Lactococcus lactis subsp. lactis KLDS 4.0325
Pathway
lld03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lld00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    P620_09860
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lld03400]
    P620_09860
Enzymes [BR:lld01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     P620_09860
DNA repair and recombination proteins [BR:lld03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     P620_09860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 SH3_13 Viral_helicase1 AAA_11 HHH_5 UvrD_C HHH AAA_22 HHH_8 5_3_exonuc IMS_HHH Herpes_Helicase AAA_12 T2SSE AAA_28 Zeta_toxin UvrD-helicase NTPase_1
Motif
Other DBs
NCBI-ProteinID: AGY44623
Position
complement(1917554..1920058)
Genome map
AA seq 834 aa AA seqDB search
MIEKTYFTGSIEAIFFSNPSNFYKVLLIEIDETNAEYDNFEIVVNGTIGDVVEGDSYTFY
GQLTQHPKYGEQLQVSQYEKAVPTSGAGLVKYFSSDKFPGIGKKTAEKIVETFPENTVDS
ILEAPEKLDGLLTLARKNSFIKRLRENHGMEKVLTKLAEYGLPSKITFQIYELYKEETIE
KIEENPYQLVEDVKGVGFKTADKIASSLGIEADSPNRFRAALMHEVNTHSQSTGDTYIEA
KNLLEMTIDLLEEARNVEVNPSAVAEEINGLIVDGKVQQEGTKIFENSLYFAEDGIRKSL
TALTNRSGKDFADEKLLTVLAEVERDLEITYDDLQKQAIIGAMNQQFFILTGGPGTGKTT
IINGFIETYARLHQLDLDPDHYNDDVFPILLAAPTGRASRRMNELTGLPAATIHRHLGLG
QDEAEDSLGNELSGALLIVDEFSMVDTWLANKLFQAIPGSMKVLLVGDADQLPSVGPGQI
FADLLKIPEIPLVKLDKIFRQGDDSTITDLAHHIKDGQLPSDFTAKKPDRSYFEVSANFV
PQMVEQIASAWQKRGNNPFELQILAPMYKGMAGINAMNVLLQNLFNPLNDRLEFALGDMK
FREGDKVLHLVNDAEANVFNGDLGQIVELIAAKYTDSKQDELVMDFDGQELTYPRAEWYK
ITLAYAMSIHKSQGSEFSTVIVPMVSSYSRMLERNLLYTAITRAKQSLILLGEERAFAQA
VAREGANRKTYLIERFMGENPAAKTLSVEIVSEKVTDKKERSDKEKKPAAPVELQGQIRS
VSKKMPAQVEEISLFEDKEIEALDKGSLTEALILSGNFDPLIGLTQQDFAIFNK
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaaaaacttattttactggttcgattgaggcaatatttttctccaatcccagt
aatttttataaagttctactcattgaaattgatgaaactaatgctgaatatgataatttt
gaaattgtggttaacgggacaattggggatgtggttgaaggagattcttatacattttat
ggtcaattgacgcagcatcctaaatatggggaacaattacaggtcagtcaatatgaaaaa
gcagtgccgacttctggtgctggtttagttaaatatttttcttcagataaatttcctgga
attggtaagaaaacggcagaaaaaattgttgaaacttttcctgaaaatacggtagattca
attttagaagcgccggagaaattggatggtctattgaccctagccagaaaaaattcattt
atcaaacgattacgtgagaatcatggaatggaaaaagtgctgaccaagcttgcagaatat
ggcttaccaagcaaaatcacttttcaaatttatgaactttataaagaagaaacgattgaa
aaaattgaggaaaatccttatcagcttgtggaagatgttaagggagttggttttaaaaca
gctgataagattgcaagtagtttaggaattgaagcggatagccctaatcgatttcgagcg
gcattgatgcatgaggtcaatacacattcgcaatcaacaggcgatacttacattgaagcc
aaaaatttacttgagatgacgatagacttacttgaagaagctcgtaatgtcgaggtcaac
ccgtctgctgttgcggaggaaattaatggtttaatagttgatggaaaagtgcaacaagaa
ggaacaaaaatatttgagaattccttgtacttcgctgaggacgggattcggaaatcactg
acagcattaactaatcgttcgggtaaagattttgctgatgaaaagttactgacagtattg
gctgaagttgaaagagatttagaaattacttatgatgatttgcaaaagcaagccattatt
ggtgcaatgaatcagcaatttttcattttgactggtggaccaggaactggtaaaacaaca
attattaatggttttattgaaacttatgcccgtcttcatcagctagatttggacccagac
cattataatgatgacgtctttcctatattactggcagcaccgactggtcgagcttcaaga
cggatgaatgagttgactggtcttccagcagcgacgattcaccgccatttgggtttggga
caagatgaagcagaagattctcttggaaatgaattgtctggtgctcttttgattgttgac
gaattttctatggttgatacttggttagctaataaactttttcaagcgattcctggttca
atgaaagttctccttgttggagatgctgaccagcttccttctgtggggccaggacaaatt
tttgcggatttactaaaaattccagaaattccgttagtaaaattggataagatttttcgt
caaggggatgattctaccattactgatttagctcaccacatcaaagatgggcaattgcca
agtgatttcacggcgaaaaaacctgaccgttcttattttgaggtcagtgcaaattttgtt
cctcagatggttgaacaaatcgcaagtgcatggcaaaaaagagggaataatccttttgaa
ttacaaatcttagcgcctatgtataaaggaatggccggaattaatgcaatgaatgttctt
ttgcaaaatctctttaatccgcttaatgaccgacttgaatttgctttgggtgatatgaaa
tttcgtgaaggagataaagttcttcatttagtaaatgatgctgaggccaatgtatttaac
ggagatttgggacaaatcgtagaattgattgcagcaaaatatactgatagtaaacaagat
gagttggtgatggattttgatggtcaagaattgacttatccaagagcggagtggtataaa
attactctggcttatgcgatgtccattcataaatctcaaggttcggagttttccacagtt
attgtgccgatggtttcttcgtattcacgcatgttagagcgaaatttgctttatacggca
attacaagggctaaacaaagtctgattttacttggtgaagaacgagcttttgcacaagcg
gtggcgcgtgaaggagcgaatcgaaagacctatctgattgagcgatttatgggagaaaat
ccagcggctaaaactctgtcagtagaaattgtgagtgaaaaagttactgacaaaaaagaa
agatctgacaaagagaagaagcctgcagcgccagtagaattacaagggcaaattcgttct
gtcagtaaaaaaatgccagcacaagtagaagaaatttctttatttgaagataaagaaatt
gaagcactggataagggaagcttgacagaagcacttattttgtcaggaaattttgaccct
ttaattggtttaactcaacaagactttgcaatctttaataaataa

DBGET integrated database retrieval system