KEGG   Lactococcus lactis subsp. lactis KLDS 4.0325: P620_10085Help
Entry
P620_10085        CDS       T02882                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lld  Lactococcus lactis subsp. lactis KLDS 4.0325
Pathway
lld00071  Fatty acid degradation
lld00072  Synthesis and degradation of ketone bodies
lld00280  Valine, leucine and isoleucine degradation
lld00362  Benzoate degradation
lld00380  Tryptophan metabolism
lld00620  Pyruvate metabolism
lld00630  Glyoxylate and dicarboxylate metabolism
lld00640  Propanoate metabolism
lld00650  Butanoate metabolism
lld00900  Terpenoid backbone biosynthesis
lld01100  Metabolic pathways
lld01110  Biosynthesis of secondary metabolites
lld01120  Microbial metabolism in diverse environments
lld01130  Biosynthesis of antibiotics
lld01200  Carbon metabolism
lld01212  Fatty acid metabolism
lld02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lld00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    P620_10085
   00630 Glyoxylate and dicarboxylate metabolism
    P620_10085
   00640 Propanoate metabolism
    P620_10085
   00650 Butanoate metabolism
    P620_10085
  Lipid metabolism
   00071 Fatty acid degradation
    P620_10085
   00072 Synthesis and degradation of ketone bodies
    P620_10085
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    P620_10085
   00310 Lysine degradation
    P620_10085
   00380 Tryptophan metabolism
    P620_10085
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    P620_10085
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    P620_10085
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    P620_10085
Enzymes [BR:lld01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     P620_10085
Exosome [BR:lld04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   P620_10085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGY45785
UniProt: U5PTZ0
Position
1963113..1964261
Genome map
AA seq 382 aa AA seqDB search
MSFKNPVGIIAANRLPIGKINGFYKKISPETLYQNLIKQQFNKNLLLKKADIDYIILGNV
TNQGGNLARRCALKAGFSSQVPAFTIDQQCGSGLTAMISSANYIISGEASVICTGGVEST
SQANIVLDSESYQPINRFKMAPEPYEDFDMGTIADMTALKYNIPRSVQDLYALNSHKKAT
QAIEGKLLENEVFPYQDEGFTISSDQTVRPKSSMEALSKLTPAFTTNGTATAGNSCPIND
GASSIILSSTNNPFDFQGYYLGQTTIALSPSDFLLGPIKATEKLLQKFNLKLNDIEAIEL
NEAFASQAILFQNYFKLDDIKLNAYGGSLAFGHPYGATGGILISRLLNRLNQVQKPCLGI
ATLCVAGGMGISVLIGNQWYQK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaaaaatcccgtcggtatcatagcagcaaaccgtttacctataggaaaaatc
aatggtttttataaaaaaatttctcctgaaactttatatcaaaatctaattaaacaacaa
tttaataaaaatctacttctcaaaaaagctgatattgactatattattttgggaaatgtg
actaatcaaggaggaaatttagctcgacgttgtgccttaaaagcaggattttctagccag
gtcccagcttttacaattgaccagcagtgcggttctggactgacagctatgattagctct
gcaaactacattatttctggtgaagcttccgttatttgtacaggaggggtagaaagcaca
tctcaagccaatattgtgcttgattcagagagttatcagccgattaaccgatttaaaatg
gctcctgaaccctatgaagatttcgacatgggaacaattgccgatatgacagccctaaaa
tacaatattcctcgtagtgttcaagacctttacgctctaaatagtcataaaaaagcgact
caagctattgaaggaaaacttttagaaaatgaagtttttccctatcaagatgaaggattt
acaataagtagcgatcaaactgttcgtcctaaatcctcaatggaagctttgagcaaatta
acccctgcttttaccactaacggaacagccactgctggaaactcttgcccaataaacgat
ggtgcttcttcaatcatattgtcatccactaataatccttttgattttcaaggctattat
ttaggacaaacaactattgctttatctccatcagatttcttattaggcccaataaaagca
actgaaaaacttttacagaaatttaaccttaaacttaatgatattgaggctatcgaatta
aatgaagcctttgccagtcaggccattttattccaaaattattttaagcttgatgatata
aaattaaatgcttatggtggttcccttgcatttggtcatccttacggtgcaactggtggc
attctaatttctcgactcttaaatcgcctaaaccaagtgcaaaaaccatgtcttggcatc
gcaactttgtgcgtagctggaggtatgggaatcagtgtactgataggtaatcaatggtat
caaaaatga

DBGET integrated database retrieval system