KEGG   Lactococcus lactis subsp. lactis KLDS 4.0325: P620_13155Help
Entry
P620_13155        CDS       T02882                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
lld  Lactococcus lactis subsp. lactis KLDS 4.0325
Pathway
lld00030  Pentose phosphate pathway
lld00480  Glutathione metabolism
lld01100  Metabolic pathways
lld01110  Biosynthesis of secondary metabolites
lld01120  Microbial metabolism in diverse environments
lld01130  Biosynthesis of antibiotics
lld01200  Carbon metabolism
Module
lld_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:lld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    P620_13155
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    P620_13155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lld04147]
    P620_13155
Enzymes [BR:lld01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     P620_13155
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     P620_13155
Exosome [BR:lld04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   P620_13155
  Exosomal proteins of colorectal cancer cells
   P620_13155
  Exosomal proteins of bladder cancer cells
   P620_13155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N OspE
Motif
Other DBs
NCBI-ProteinID: AGY45069
Position
2499057..2500568
Genome map
AA seq 503 aa AA seqDB search
MTEQKQALFTIFGATGDLAKRKLYPSLFRLFKKGELADNFAVIGTARRPWTNEYYREVVL
ESIKDLMNSKTEAENFASHFYYQSHDVSDSSHYVNLKDLGEKLRKQYKTAGNQVFFLAMA
PQFFGTISEHLKSENILTGEGFERIVIEKPFGTSYDTAKSLNDSLAKVFSEEQIFRIDHY
LGKEMIQAVSAVRFANPIFESLWNNQHIDNVQITFAEFIGVEDRGGYYETSGALKDMIQN
HVLQVLSLIAMEKPEKFDESYIVKEKVKALNAIRQYSSEEALENFVRGQYIAGRFDGEDY
LGYREEDSVATDSRTETFAAGKFVIDNERWSGVPFYVRSGKRMTEKGTRINIVFKKDKDN
LFAENCDDQSVQNVLTIYIQPTEGFSLSVNGKAAGQGFHLEPLRLNFRHDSEFLGNSPEA
YEKLFLDVLNGDGTNFSHWEEAARAWELIDVIREAWDKETSELPTYAARTMGPKAAFDLL
EKNGHEWAWQPDLWYQERGYYNK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacaaaaacaagcacttttcaccatcttcggagcaactggtgacctcgctaaa
agaaagctctacccttcactctttcgcctcttcaaaaaaggtgaactagctgacaatttt
gcagtcatcggtaccgctcgccgtccatggacaaacgagtattatcgtgaagttgtttta
gagtctatcaaagatttaatgaactcaaaaacggaagccgaaaatttcgccagccatttt
tattatcaaagtcacgatgttagcgacagctcacattacgttaacttaaaagatttgggt
gaaaaattgcgtaaacagtataaaactgctggcaatcaagtcttctttttagcaatggct
cctcaattttttggcactatctctgaacaccttaaatcagaaaatattttgacaggtgag
ggttttgagagaatcgtcattgaaaaaccatttggaacaagctacgatacggcaaaatca
cttaatgacagcctcgcaaaagtatttagtgaagaacaaattttccgaatcgaccactac
cttggaaaagaaatgatccaggccgtttctgccgttcgttttgccaatccaatctttgaa
tcgctttggaataatcaacacattgataacgttcagattacttttgccgaatttatcggt
gttgaagaccgtggcggttactacgaaacttctggtgctttaaaagatatgattcaaaac
catgtcttacaagtactcagcctcattgccatggaaaaacctgaaaaatttgatgaatct
tatattgtaaaagaaaaagttaaagcccttaatgcaatccgtcaatattcttctgaggaa
gctttagaaaacttcgttcgtggtcaatatatcgcaggacgttttgacggtgaagattac
ctaggctatcgcgaagaagattctgttgcaacagacagtcgaactgaaactttcgctgct
ggaaaatttgtcattgataatgagcgttggtcaggcgtccctttctatgttcgctcagga
aaacgtatgactgaaaaaggaactcgtattaatatcgttttcaaaaaagataaagacaat
ctctttgcagaaaattgcgatgaccaatccgttcaaaatgttttgaccatttatattcaa
ccaactgaagggttttcactttcagtaaatggaaaagcggctggtcaaggcttccattta
gagcctttgcggttaaatttccgacacgatagtgaatttcttggaaattctcctgaagca
tatgaaaaacttttcctagatgtccttaatggagacggaacaaatttctcacattgggaa
gaagcggctcgcgcctgggaacttattgatgttattcgagaagcttgggataaagaaact
tctgagcttccaacttatgcggctcgcacaatgggacctaaggctgcatttgacttacta
gaaaaaaatggtcacgaatgggcttggcaacctgatttatggtatcaagaacgtggttac
tacaataaataa

DBGET integrated database retrieval system