KEGG   Lactobacillus lindneri: AYR59_00415Help
Entry
AYR59_00415       CDS       T04666                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lle  Lactobacillus lindneri
Pathway
lle00450  Selenocompound metabolism
lle00970  Aminoacyl-tRNA biosynthesis
lle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lle00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AYR59_00415
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AYR59_00415
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lle01007]
    AYR59_00415
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lle03016]
    AYR59_00415
Enzymes [BR:lle01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AYR59_00415
Amino acid related enzymes [BR:lle01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AYR59_00415
Transfer RNA biogenesis [BR:lle03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AYR59_00415
 Prokaryotic type
   Other AARSs
    AYR59_00415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f tRNA-synt_1c KAR ARL2_Bind_BART
Motif
Other DBs
NCBI-ProteinID: ANZ58619
Position
complement(80293..82344)
Genome map
AA seq 683 aa AA seqDB search
MSDTKSTFYITTPIYYPSGRLHIGNSYTTVAADALARYHRELGDDVYYLTGTDEHGLKIE
QKAEKLGIKPQAYVDKMAQSIKDLWMNLDVSNDDFIRTTDHRHVQAVQKIFQQLLDQGDI
YLGKYTGWYSVSDEEYFTESQLEEVYKDDQGNITGGKAPTGNEVQLVNEECYFFKMSKYA
DWLMNYYKEHPDFIQPTSRMHEMINNFLKPGLEDLAVSRTTFNWGIPVKSNPKHVVYVWI
DALTNYITDLGYDSDNDKLFKKFWPANLQMIGKEIVRFHCIYWPIILHALGLPLPKEIYA
HGWITMKDGKMSKSKGNAVYPEDLVDRYGLDATRYYLLKAVPFSGDGVFTPEDFVDRINY
DLANDLGNLLNRTIAMINKYENGISPDYTATDDEPSRELQEMAVSVTKEYKELMDTVHLS
DALSSVWKLIGQTNKYIDQTEPWKLAKTQAENPEDAKALANVMAHLAASLRLIAILVSPA
IPNAAFRIYNQLGLNDGNEFDIKNASLDGFKGGRKVVVNGEPIFPRVDWNEEVDYIKSKM
TAPEKTKGRAAMKRAETKKETKHVGVTTLKNLKNEVDFADFEKVELKVAEIKSVVKVAKA
DKLLKFELDAGDDGQRQIVSGIAKWYPDFEKLVGKKVIIVANLKPIKLRGEVSQGMILSV
EKQNGDIQVVTVDPTLENGSTLA
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatacaaagtcaacattttatattacgacaccaatttattatccatctggtaga
ttgcacattggaaactcctatacgactgtagctgccgatgcattggcacgttatcaccgc
gagttaggtgatgatgtttattatttaacgggaaccgatgaacacggtctaaaaattgaa
caaaaggctgaaaaattagggattaaaccacaagcttatgttgataaaatggcacaaagt
atcaaagacttatggatgaatctagacgtttcaaatgatgattttatccgaacaactgac
catcgtcatgttcaagctgttcaaaagatttttcaacaattgttggatcaaggagatatt
tatttaggtaaatacacaggttggtattcagtttctgatgaagaatacttcactgaatca
caactagaagaagtttataaagatgaccagggtaatataactggggggaaagctccgact
ggaaacgaagttcagttggtaaatgaagaatgctatttctttaaaatgagtaaatatgct
gattggttaatgaattattacaaagaacatcctgattttattcaacctacttctcggatg
catgaaatgattaataacttcttaaaaccaggattggaagatttggcagtttcacgaacg
acttttaactgggggattccagttaaatctaatcccaagcacgttgtctacgtttggatt
gatgccttgaccaactatattactgatctaggctacgatagtgataacgataaactattt
aagaaattttggcctgctaatctccagatgattggaaaagaaattgtgagattccattgt
atttattggcctattattttacatgcccttggattacccttacctaaagaaatttatgcc
cacggttggattactatgaaagatggtaagatgtctaaatctaaaggaaatgcagtttac
cccgaagacttagttgatcgttatggtttagatgcaactcgttattacctactaaaggca
gttccattttcaggtgacggagtgtttactccagaagactttgtagatcggattaattat
gatttagccaatgaccttggaaacctgttaaatcgtaccattgccatgattaataagtat
gaaaatgggatttccccagattatactgctacagatgacgaacctagtcgcgagttacaa
gaaatggcagttagtgtgactaaagaatataaagaattaatggacacagtacatttgtca
gatgcattgtcatctgtttggaaattaattggccaaacgaataagtatattgatcaaacc
gaaccttggaaattagctaaaactcaagctgaaaatcctgaagatgctaaggcattggca
aatgtgatggcacatttagctgctagtttgcggttgattgctattttagttagtccagct
atccctaatgcggcttttagaatttataatcaattaggattaaatgatggtaacgagttt
gacatcaaaaatgctagtttagatggatttaaaggtggtcgtaaggttgttgtaaatggt
gaaccaattttcccacgcgttgactggaatgaagaagttgactacatcaagagtaaaatg
acagctcctgaaaaaactaaaggccgagcagctatgaagcgtgctgaaactaaaaaagaa
actaagcatgttggggtaactacacttaagaatcttaaaaatgaagtcgattttgctgat
tttgaaaaagttgaattaaaagtagctgaaattaaatcagtggttaaagttgccaaagcc
gataaacttttgaaatttgaattggatgctggggacgatggacaacgtcaaattgtttcc
ggaatcgctaagtggtatcctgattttgaaaaactggtcggtaaaaaagtaatcattgtt
gctaatttaaaaccaatcaaattacgcggggaagtcagtcagggaatgattttgtcagtt
gaaaaacaaaatggagacattcaagttgtgactgttgatccaacacttgaaaatggtagt
acattagcataa

DBGET integrated database retrieval system