KEGG   Lactobacillus lindneri: AYR59_01950Help
Entry
AYR59_01950       CDS       T04666                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lle  Lactobacillus lindneri
Pathway
lle00071  Fatty acid degradation
lle00072  Synthesis and degradation of ketone bodies
lle00280  Valine, leucine and isoleucine degradation
lle00310  Lysine degradation
lle00380  Tryptophan metabolism
lle00620  Pyruvate metabolism
lle00630  Glyoxylate and dicarboxylate metabolism
lle00640  Propanoate metabolism
lle00650  Butanoate metabolism
lle00900  Terpenoid backbone biosynthesis
lle01100  Metabolic pathways
lle01110  Biosynthesis of secondary metabolites
lle01120  Microbial metabolism in diverse environments
lle01130  Biosynthesis of antibiotics
lle01200  Carbon metabolism
lle01212  Fatty acid metabolism
lle02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AYR59_01950
   00630 Glyoxylate and dicarboxylate metabolism
    AYR59_01950
   00640 Propanoate metabolism
    AYR59_01950
   00650 Butanoate metabolism
    AYR59_01950
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AYR59_01950
   00072 Synthesis and degradation of ketone bodies
    AYR59_01950
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AYR59_01950
   00310 Lysine degradation
    AYR59_01950
   00380 Tryptophan metabolism
    AYR59_01950
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AYR59_01950
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AYR59_01950
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AYR59_01950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lle04147]
    AYR59_01950
Enzymes [BR:lle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AYR59_01950
Exosome [BR:lle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AYR59_01950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III CtnDOT_TraJ
Motif
Other DBs
NCBI-ProteinID: ANZ58891
Position
complement(401138..402316)
Genome map
AA seq 392 aa AA seqDB search
MEKIAIISAKRTPIGKINGNLKGLSSVELGTIAVKATLAAANLDPSAIDQVIFGNVIQAG
GGQNIARQIELNAGIPATSTACTINQVCGSGMKAVRMGQTAILNGDAEVVIVGGTESMSN
APYLNPKTRAGHKFGAFTMEDSIETDGLNDAKTNEPMGITAENVAEKFNISRADQDNFSL
ASHQKAAEAIKNDYLNDEMIPITINGKKETITYTQDETVRPDTNLEQLSKLNPAFKKAGT
VTAGNAASLNDGASALILMKESKAEKLGIKPLAIIDEYAEAGCDPKIMGYAPYYAVNKLL
QKQNKTISDFDLFELNEAFASQSIAVSRDLNIPDDKLNITGGAIAMGHPLGDSGSRILIT
LINNLRRTKQKSGLATLCIGGGMAMAMSIHLK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaattgcaatcataagtgccaaacgtactcccattggaaaaattaacggtaat
ttaaaaggtttatcatctgtagaattaggaaccatcgcagttaaagcaactctagcggca
gctaatcttgatccatctgcaattgatcaagtgatttttggcaatgtcattcaagccggc
ggcggtcaaaatatagcacgccaaattgaactaaatgctggaattccagctacaagtact
gcgtgtaccattaaccaagtatgtggatctggtatgaaagccgttcgcatgggtcaaact
gcaatcttgaatggtgacgctgaggtagtaattgtgggaggaaccgaaagcatgtcaaat
gctccctacctaaatcctaaaactagagcaggtcataaatttggtgcatttactatggaa
gatagtatcgaaactgatggcctcaatgatgccaaaaccaatgaaccaatgggcattaca
gccgaaaatgttgcagaaaaattcaatatttctcgagcagaccaagataacttttcatta
gcatcacatcaaaaagccgccgaagctatcaaaaatgattacttaaatgacgaaatgatt
cccatcacaattaatggtaaaaaagaaacaattacttatactcaagatgaaacagtccgt
cctgatacaaatctagagcagcttagcaaattaaatcctgcctttaaaaaagcaggaact
gttacagctggaaatgctgctagcttaaatgacggtgcatctgctcttattttaatgaaa
gaaagtaaagcagagaagctgggaattaaacctttagcaattattgatgaatatgctgaa
gccggatgcgatccaaaaattatgggatatgcaccctactacgctgtaaacaaattattg
caaaaacaaaataaaactatttcagattttgatttgttcgaactaaatgaggcttttgct
tctcaaagtattgctgtatcacgtgatttaaacattcctgatgataaattaaatattact
ggcggagcaattgcaatgggacatccgcttggagattcaggatctcgaattttaatcacc
ctcattaataatttaagacggaccaaacaaaaaagtggtttagccacattatgtattggt
ggaggaatggcaatggcaatgagcatccatttgaaataa

DBGET integrated database retrieval system