KEGG   Lactobacillus lindneri: AYR59_03615Help
Entry
AYR59_03615       CDS       T04666                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
lle  Lactobacillus lindneri
Pathway
lle00670  One carbon pool by folate
lle01100  Metabolic pathways
lle01120  Microbial metabolism in diverse environments
lle01200  Carbon metabolism
Module
lle_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:lle00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AYR59_03615
Enzymes [BR:lle01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     AYR59_03615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: ANZ59179
Position
763521..765182
Genome map
AA seq 553 aa AA seqDB search
MKSDIEIAQAATMWPIEKVAKQAGFVSDEVIPYGKNTAKIEINEQLHKNENGKLVLVTSI
NPTPAGEGKSTVAVGLADALNLAHHKTMLALREPSLGPVMGMKGGATGGGMSQVLPMDDI
NLHFTGDFHALTIAQNTLMALVDNSIYQGNKLNLDPRQVLLKRVLDVNDRELRHIVVGLG
GRTSGVPRESGFDITAASELMAILTLSTDLNDMQRRINKIVVGYTYDKKPVTVAELGVAG
AITTLLKDAIKPNLVQTMGHTPTLIHGGPFANIAQGTNSIQATKIALKMGDYAVTEAGFG
ADLGGEKFLNVKTPLLGKHPDTIVIVATVRALKMHGGMDKKDLNHEDTAALQKGLANLGQ
HISSMKRYGVPVVVAINKFTNDTDAELKMIEDYADQQGVKAYPADVWGQGGQGATDLAAG
VVTATEQPADFQPLYQPDDSITTKLNKIVQVIYGGKGIELSPKAKKQIASFEKLGWDKLP
IIVAKTQYSLTDDAKQIGKPEDFVIHIREFVPKLGAGFLVAMAGNILTMPGLPKDPAANH
IEIDNDEKITGLF
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtgatattgaaattgcacaagctgcaactatgtggccaattgaaaaagtagct
aaacaagctgggtttgtttcagatgaagtgattccttacggaaaaaataccgctaagatt
gaaataaacgaacagctgcataagaatgaaaacggtaagttagtgttagtgacctcaatt
aatcccactccagcaggagagggtaaatcaactgttgcagttgggctggctgatgccttg
aatttagctcatcataaaactatgttggcattacgagaaccctcacttggacctgttatg
ggaatgaagggtggagcaactggaggcggtatgtcacaagttttgccaatggatgatatt
aatttacattttactggtgattttcatgctttgacaattgcgcaaaatactttaatggca
ttggttgataatagtatttatcaaggcaacaaattgaatttagatccccgtcaagtgtta
ttaaaacgagttttagatgttaatgatcgtgagttgcgtcatattgtcgttggtttggga
ggaagaacaagtggagttcctcgtgaaagtggttttgatattacggctgcttcagaatta
atggcaattttaactttgtcgactgatttaaatgatatgcaacgcagaattaataaaatc
gtggtgggttatacatatgataaaaaacctgttacagttgctgaattaggagttgcggga
gcaattactaccttattaaaagatgcaattaagcccaacctagttcaaactatgggacat
actccaactttgattcatgggggaccttttgcaaatattgcccagggaactaattcaatt
caggctactaagattgccttgaaaatgggtgattatgcggtaactgaagccggatttggt
gctgacttaggtggagaaaaattcttaaatgttaagacaccacttttaggaaaacatcca
gatacaattgtgattgttgctactgtcagagctttaaagatgcatggtggaatggataaa
aaagatcttaatcacgaagatacagctgctttacaaaaagggctggcaaacttagggcaa
catattagtagcatgaaacgttatggtgtcccagtggtagttgccattaataaatttact
aatgataccgatgctgagttaaaaatgattgaagattatgcagaccaacaaggtgtgaaa
gcttatcctgctgatgtgtggggtcaaggtggacaaggtgctactgatttagctgctggc
gttgtaactgctactgaacaaccagctgattttcaacctttatatcaaccagacgatagt
attactactaaattaaacaaaattgttcaagtaatttatggtggcaaagggattgaattg
tcaccaaaagccaaaaagcaaattgctagttttgaaaaattaggctgggataagttacca
attattgttgccaagacccaatattcattaactgatgatgcaaaacaaattggaaaacct
gaagattttgtgattcatattcgtgagtttgtgcctaagttgggtgccggtttcttagtt
gcgatggctggtaacattttgacaatgcccggactgcccaaagacccagctgctaatcat
attgagattgataatgatgaaaagattaccggattgttctaa

DBGET integrated database retrieval system