KEGG   Lactobacillus lindneri: AYR59_03755Help
Entry
AYR59_03755       CDS       T04666                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lle  Lactobacillus lindneri
Pathway
lle03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lle00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AYR59_03755
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lle03011]
    AYR59_03755
Ribosome [BR:lle03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AYR59_03755
  Bacteria
    AYR59_03755
  Archaea
    AYR59_03755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ANZ59197
Position
790948..791304
Genome map
AA seq 118 aa AA seqDB search
MAEQVTSAKAIAKTVRIAPRKVRLVLDLIRGKNVAEATSILEFTPRGASPVVEKVLKSAV
ANAENNFDLDGQDLVISEAYADEGPTLKRFRPRAKGSASPINKRTSHITIVVSEKKEG
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaagttacatcagcaaaagctattgccaaaactgttcgtattgcccctcgt
aaggtccgccttgttttagatcttattagaggaaagaacgtagcagaagctacttctatt
ttagagttcacccctcgaggtgcttctccagtagtagaaaaagttttgaaatcagctgta
gcaaatgcagaaaataattttgaccttgatggtcaagacttagttattagtgaagcatac
gcagacgaaggtccaaccttaaagcgtttccgtccccgtgccaagggttcagcttcacca
atcaataaaagaacaagtcacattacaatcgtagtatcagaaaagaaggagggatag

DBGET integrated database retrieval system