KEGG   Leuconostoc lactis: BCR17_00255Help
Entry
BCR17_00255       CDS       T04460                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
llf  Leuconostoc lactis
Pathway
llf00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:llf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BCR17_00255
Enzymes [BR:llf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BCR17_00255
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BCR17_00255
    1.1.1.-  
     BCR17_00255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 ADH_N_assoc Glu_dehyd_C 2-Hacid_dh_C TrkA_N PALP FtsJ Pyr_redox_3 Ribosomal_L19
Motif
Other DBs
NCBI-ProteinID: ANY10932
UniProt: A0A1B1ZYW2
Position
complement(49843..50895)
Genome map
AA seq 350 aa AA seqDB search
MKAAVWHGVKDVRVEDVTLKPLKANEVVVRVAYAGICGSDLHEYLEGPVFIPVEQPDGLT
GGQAPLTMGHEFSGVVEQVGADVTDFKVGDHVSVNPTVTKGEVADDVDVYDGYSFIGLST
DGGFTTHVNVPEANLYHLPQDFPLTLAATIEPTAVAVQAVKEGGLRFGEKVVIFGAGPIG
VLVAAAAKAAGATKIVAVDLSAVRLEKALEMGATDVVNPSEVDDTIAAIKAIIPGGADVT
FEVAGVQPTFEQAIAATRPRGTMVIVSIFAKPISFDPMQLMNAGVKLTTTIAYSKETFQQ
TVDLVSQGLIDVAPVITDMIALDNIVTDGFESLTTDKSQAKILVNLADEE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgtatggcatggtgtaaaggatgtacgtgttgaggacgtgacgttaaaa
ccgttaaaggcaaatgaagttgtggttcgtgttgcctatgcgggtatttgtggcagtgat
ttacatgaatatctggaggggcctgtctttattccggttgaacaaccggatggtttgaca
ggcggtcaagcaccgctaaccatgggacatgaattttctggggtggttgaacaggttggc
gctgatgtgactgactttaaagttggggatcatgtgtcagttaatccaactgtcactaag
ggtgaagtcgcagatgatgttgatgtgtatgatggatatagttttattggtttgagtaca
gatgggggctttactacccatgtgaatgtcccagaagctaacttgtaccatttaccacag
gactttccacttaccttagctgcgacgattgaaccaactgccgtagccgtacaagccgtt
aaagaaggtggcttgcgctttggtgaaaaagtggtcatctttggggctggaccaattggt
gtgttggttgccgcagcggctaaggcagcaggggcgactaaaattgtggccgttgatttg
tcagcggttcgactcgaaaaagctttggaaatgggtgccactgatgtggtgaatcccagt
gaagttgacgatacaattgctgccattaaagccattatccctggtggtgccgacgtgacg
tttgaagtagctggggtgcaaccaacatttgaacaagcgattgctgccacgcgcccacgc
ggtaccatggtgattgtgtcaatttttgctaaaccaattagttttgacccgatgcaatta
atgaacgctggcgttaagctgacgacaacgattgcttattctaaagagactttccaacaa
accgttgatttggtgagccaagggctaatcgatgtggcgccagtgattaccgatatgatt
gcattggataacattgtcaccgatggttttgagtcattgacgacggataagtcacaggcg
aaaattttagtgaacttagcagacgaagaatag

DBGET integrated database retrieval system