KEGG   Legionella lansingensis: 44548918_00735Help
Entry
44548918_00735    CDS       T05543                                 

Gene name
bphI
Definition
(GenBank) 4-hydroxy-2-ketovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
llg  Legionella lansingensis
Pathway
llg00360  Phenylalanine metabolism
llg00362  Benzoate degradation
llg01100  Metabolic pathways
llg01120  Microbial metabolism in diverse environments
llg01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:llg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    44548918_00735 (bphI)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    44548918_00735 (bphI)
   00622 Xylene degradation
    44548918_00735 (bphI)
   00621 Dioxin degradation
    44548918_00735 (bphI)
Enzymes [BR:llg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     44548918_00735 (bphI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like Urease_alpha Glyco_transf_21
Motif
Other DBs
NCBI-ProteinID: SNV48570
Position
1:763702..764556
Genome map
AA seq 284 aa AA seqDB search
MTQRVEVFDVSLRDGGHRTDFNFQDEVLEQILTAVDRSGIEYIEIGYRNGPIQVIKNIGR
AGLCQRDYLHFCAPLIRQAKIAVMVYPRNIAILDIKELEACGVTLLRICVPKGQLAEAAA
IAAIAKQTGLKISFNFINMSQYAENELDKIIEAALQYAPDIIYLADSNGSVLPDKISSLY
KKYTSQCSLPFGFHAHDNLGLAQANAIAAIHAGATYIDASLGGMGKGIGNLRTEFFAAYL
QATKIKDYNLQALLSASNYVREVLKIGQEGIELDEFNRAIANDL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaagagtagaagtattcgatgtctccctacgcgatggcggccatcgaacagat
tttaattttcaagatgaagtgctagaacagatcttaactgcagttgatcgatcaggcatt
gaatatattgaaattggttatcgtaatggtccaatacaagtcataaaaaatattgggcga
gcaggtctatgccagcgcgattatctccatttttgtgctcccttgataaggcaagccaag
atagctgtgatggtatatccacgtaatatcgctatcctagatattaaagaattagaagct
tgcggtgttactctgttgcgaatttgtgttcctaaaggtcaattggctgaggctgctgca
atcgcagcgattgctaaacaaacgggtttaaagatctcattcaatttcattaatatgtcc
cagtatgctgagaatgaattggataagattatagaagcagctctgcaatatgcaccagat
atcatctacttggcagattcaaatggtagtgtattgcctgataaaattagttccctctat
aaaaaatataccagtcaatgtagcctcccatttggttttcatgcacatgataatttaggt
ttggcgcaagcaaatgcaatagctgccattcatgctggagctacttacattgatgcttct
ttaggagggatggggaaaggaatcggtaatcttaggacggaattttttgctgcttatctc
caagcaactaaaataaaggactataatttgcaagccttgttgtcagcatctaactatgtg
cgtgaggttttaaaaataggacaagaaggaatcgaactggatgagtttaatcgagccatt
gcaaacgatttataa

DBGET integrated database retrieval system