KEGG   Legionella lansingensis: 44548918_02009Help
Entry
44548918_02009    CDS       T05543                                 

Gene name
phhA
Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
llg  Legionella lansingensis
Pathway
llg00360  Phenylalanine metabolism
llg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
llg00790  Folate biosynthesis
llg01100  Metabolic pathways
llg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:llg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    44548918_02009 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    44548918_02009 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    44548918_02009 (phhA)
Enzymes [BR:llg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     44548918_02009 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: SNV52561
Position
1:complement(2186404..2187222)
Genome map
AA seq 272 aa AA seqDB search
MEFVSRYVAHQPDAQGMVDYSNEEHRIWQILYERQIKILPGRACDEFIQGLEMLDLGPQR
IPQLPEITRRLKALTGWEVAPVAALISAREFFQLLAERCFPAATFIRCEEEVDYVKEPDI
FHELFGHCPMLTHPVYADFVCNYARKVLSLPEERWPLLQRLFWFTVEFGLIKTHQGLRAY
GGGILSSISETPYSVESDAAMRVLFDPVVAFRTPYRIDMLQRVYFVIHSYQELYDFVEAD
IVRLMDRAQELGEYPPFFPVDKDNPSIHILAC
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgtcagtcgttatgttgctcatcaacctgatgcccagggtatggtggattat
tcaaatgaagagcatcggatttggcaaatactttatgaacgtcagataaaaattttacct
ggaagagcgtgtgatgaatttatccaaggtttagaaatgcttgatcttggacctcaaaga
ataccccagttgccagagatcactcgtcgtcttaaggctctaactggctgggaagtggcg
cctgttgccgcattaatttctgcacgtgaattttttcaacttttagctgagagatgtttt
cctgcggcgacgtttattcgctgtgaagaagaagttgattatgttaaagagccggacatt
tttcatgagctatttgggcattgccctatgctaacccatcctgtctatgctgattttgtt
tgtaattatgcccgtaaggttttaagcctgcctgaggaaagatggcctcttctgcaacgt
cttttctggtttacagtagaattcggattaattaaaacgcaccaaggtttgagagcttat
ggtggaggtattttgtcttcaatcagtgaaacgccttatagcgtcgaaagcgatgccgct
atgcgtgtacttttcgacccagttgttgcatttcgcacaccttaccgtatagatatgctg
caacgcgtttacttcgtcattcatagttatcaagagctttatgattttgttgaagctgac
attgtgagacttatggatcgtgcccaagaattaggtgagtatccacctttctttcctgtg
gataaggataaccccagtattcacattttggcttgttag

DBGET integrated database retrieval system