KEGG   Legionella lansingensis: 44548918_02251Help
Entry
44548918_02251    CDS       T05543                                 

Gene name
pitA_1
Definition
(GenBank) inorganic phosphate transporter, PiT family
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
llg  Legionella lansingensis
Brite
KEGG Orthology (KO) [BR:llg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    44548918_02251 (pitA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: SNV53905
Position
1:2435174..2436427
Genome map
AA seq 417 aa AA seqDB search
MTYPFLLFFLAIAFCFFMTWGVGANDLANVMSTTMGSKAITVRQAMIIAIIFEFAGAFLG
GSGVTETMRDGIITSSQLSNQPLILIEGMLGVLIACTVWMNLASYLGVPVSITNALVGSM
VGFGSVVLGTNAIHWQQVYHIAIGWFTSPLIAGFTGYALFISIQQTIFIKSDPLEKAKWY
VPIYLFLVGSVLSFITVFKGLNHFDIHLNLKQDLAVTLATSISLTIIGMIFIKRIPEVPR
IRRRERFLQVEKYFAVLMGLTACAMVFAHGSNDVALAVGPLTIIYSLLMNGDQPMAAANY
PAWIIFLGSAGVVIGFLMYGRKVIETVGSSITALTPSRAFAATLAAATTVVVATSTGIPV
SATQTLVGAVLGVGLARGIGALNLIVIRNIFTSWILTLPAASLLTILSYKALHILIG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgacttatccttttttattatttttccttgcgattgctttttgtttcttcatgacttgg
ggtgtgggagctaatgatcttgccaatgtcatgagcacaacgatgggatcaaaagccatt
acggtccgccaagccatgattatcgctattatttttgaatttgccggtgcctttcttggt
gggagtggcgtaactgaaaccatgcgtgatggtattattactagcagtcaattatcgaat
caaccgctaatccttattgaaggcatgcttggtgttttaattgcttgcacggtgtggatg
aatcttgcaagttatttgggtgtacctgtttctattaccaacgctttggtaggttccatg
gtaggctttggttcggtggttttaggcaccaatgcgattcattggcagcaagtttatcat
attgccattggctggtttacttccccattgattgctggattcacaggttatgctttattt
ataagtatccagcaaaccatctttattaaaagtgatccattagaaaaagccaaatggtat
gtccccatttacctctttttagtgggatcagtcttgtcttttattactgtttttaaaggt
ctgaatcatttcgatatccacctgaatttaaagcaggatttagcagtaactctagctacg
agtattagccttaccattatcggtatgatttttatcaaacgtattcctgaagtaccacgt
atccgacgacgtgaacgttttctgcaagtagagaagtattttgctgttctcatgggattg
acagcctgtgccatggtttttgcccatggttccaatgatgtagctctggcagtcggccct
ttaaccatcatatacagtttgctcatgaatggagatcagcccatggcagcggccaattat
cctgcatggattatttttcttggctctgctggtgttgttattggttttctcatgtatggt
agaaaagtaatagaaacagtgggaagttcaatcactgcgttaacaccaagccgcgctttt
gcagcgactcttgctgctgcaaccacggtcgtagtggccacaagcacaggaataccggtt
tccgcgacacagaccttggtgggtgctgtacttggcgtaggtttggctcgaggtattggt
gcattaaatttaattgttatccgtaatatcttcacatcctggattttaaccctacctgcc
gcatcattgctcactattctttcttataaagccttgcatattcttattgggtaa

DBGET integrated database retrieval system