KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_0663Help
Entry
uc509_0663        CDS       T02415                                 

Gene name
pycA
Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
lli00020  Citrate cycle (TCA cycle)
lli00620  Pyruvate metabolism
lli01100  Metabolic pathways
lli01120  Microbial metabolism in diverse environments
lli01200  Carbon metabolism
lli01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    uc509_0663 (pycA)
   00620 Pyruvate metabolism
    uc509_0663 (pycA)
Enzymes [BR:lli01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     uc509_0663 (pycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl ATP-grasp Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp_3 RnfC_N HlyD_D23 RimK ATPgrasp_Ter NQRA GCV_H PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AFW91273
Structure
PDB: 

Position
648394..651807
Genome map
AA seq 1137 aa AA seqDB search
MKKLLVANRGEIAVRVFRACNELGLSTVAVYAREDEYSVHRFKADESYLIGQGKKPIDAY
LDIDDIIRVALESGADAIHPGYGLLSENLEFATKVRAAGLVFVGPELHHLDIFGDKIKAK
AAADEAQVPGIPGTNGAVDIDGALEFAQTYGYPVMIKAALGGGGRGMRVARNDAEMHDGY
ARAKSEAIGAFGSGEIYVEKYIENPKHIEVQILGDSHGNIVHLHERDCSVQRRNQKVIEI
APAVGLSPEFRNEICEAAVKLCKNVGYVNAGTVEFLVKDDKFYFIEVNPRVQVEHTITEL
ITGVDIVQAQILIAQGKDLHTEIGLPAQAEIPLLGSAIQCRITTEDPQNGFLPDTGKIDT
YRSPGGFGIRLDVGNAYAGYEVTPYFDSLLVKVCTFANEFSDSVRKMDRVLHEFRIRGVK
TNIPFLINVIANENFTSGQATTTFIDNTPSLFNFPRLRDRGTKTLHYLSMITVNGFPGIE
NTEKRHFEEPRQPLLNIEKKKTAKNILDEQGADAVVEYVKNTKEVLLTDTTLRDAHQSLL
ATRLRLQDMKGIAQAIDQGLPELFSAEMWGGATFDVAYRFLNESPWYRLRKLRKLMPNTM
FQMLFRGSNAVGYQNYPDNVIEEFIRVAAHEGIDVFRIFDSLNWLPQMEKSIQAVRDNGK
IAEATICYTGDILDPSRPKYNIQYYKDLAKELEATGAHILAVKDMAGLLKPQAAYRLISE
LKDTVDLPIHLHTHDTSGNGIITYSGATQAGVDIIDVATASLAGGTSQPSMQSIYYALEH
GPRHASINVKNAEQIDHYWEDVRKYYAPFEAGITSPQTEVYMHEMPGGQYTNLKSQAAAV
GLGHRFDEIKQMYRKVNMMFGDIIKVTPSSKVVGDMALFMIQNELTEEDVYARGNELNFP
ESVVSFFRGDLGQPVGGFPEELQKIIVKDKSVITDRPGLHAEKVDFATVKADLEQKIGYE
PGDHEVISYIMYPQVFLDYQKMQREFGAVTLLDTPTFLHGMRLNEKIEVQIEKGKTLSIR
LDEIGEPDLAGNRVLFFNLNGQRREVVINDQSVQTQIVAKRKAETGNPNQIGATMPGSVL
EILVKAGDKVKKGQALMVTEAMKMETTIESPFDGEVIALHVVKGEAIQTQDLLIEID
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactactcgtcgccaatcgtggagaaatcgccgttcgtgtctttcgtgcctgt
aatgaactcggactttctacagtagccgtctatgcaagagaagatgaatattctgttcat
cgctttaaagcagatgaatcttaccttatcggtcaaggtaaaaaaccaattgatgcttat
ttggatattgatgatattattcgtgttgctcttgaatcaggagcagatgccattcatcca
ggttatggtctcttatctgaaaatcttgaatttgctacaaaagttcgggcagcaggctta
gtttttgttggtcccgagcttcatcacttggatatatttggtgataaaatcaaagcaaaa
gctgcggctgatgaagctcaagttcccggaattcctggaacaaatggtgcagtagatatt
gacggagctcttgaatttgctcaaacttacggatatccagtcatgattaaggcagcattg
ggcggcggcggtcgtggaatgcgtgttgcgcgtaatgacgctgaaatgcacgacggatat
gctcgtgcgaaatcagaagctatcggtgcctttggatctggagaaatctatgttgaaaaa
tacattgaaaatcctaagcatattgaagttcaaattcttggggatagtcatggaaatatt
gtccatctccacgaacgtgattgttctgttcaacgtcgaaatcaaaaagttattgaaatt
gccccagccgtaggactctcgccagagttccgtaatgaaatttgtgaagcagcagttaaa
ctttgtaaaaatgttggttatgttaatgctgggacggttgaatttttagtcaaagatgat
aagttctactttatcgaagtcaacccacgtgttcaagttgaacacacaattacagagctc
attacaggtgtagatattgttcaagcacaaattttgattgctcaaggcaaagatttacat
acagaaattggtctcccagcacaagctgaaataccacttttgggctcagccattcaatgt
cgaattactacagaagacccgcaaaatggctttttaccagatacaggtaaaatcgatacc
taccgttcaccaggtggtttcggcattcgtttggacgttggaaatgcctatgctggttat
gaagtgactccctattttgactcgcttttagtaaaagtttgtacctttgctaatgaattt
agcgatagtgtacgtaaaatggatcgtgtgcttcatgaattccgtattcgtggggtgaaa
actaatattccatttttgattaatgttattgccaatgaaaactttacgagcggacaagca
acaacaacctttattgacaatactccaagtcttttcaatttcccacgcttacgtgaccgt
ggaacaaagaccttgcactacttatcaatgattacagtcaatggtttcccagggattgaa
aatacagaaaaacgccattttgaagaacctcgtcaacctctacttaacattgaaaagaaa
aagacagctaaaaatatcttagatgaacaaggggctgatgcggtagttgaatatgtgaaa
aatacaaaagaagtattattgacagatacaactttacgtgatgctcaccagtctcttctt
gccactcgtttgcgtttgcaagatatgaaaggaattgctcaagccattgatcaaggactt
ccagaacttttctcagctgaaatgtggggtggggcaacctttgatgtcgcttatcgtttc
ttgaatgagtcgccatggtatcgtctacgtaaattacgtaaactcatgccaaataccatg
ttccaaatgcttttccgtggttcaaatgcagttggatatcaaaactatcctgataatgtt
attgaagaatttatccgcgtagctgcacatgaaggaatcgatgtcttccgtatctttgat
agcctcaactggttaccacaaatggaaaaatcaatccaagcagtgcgtgacaatggaaaa
attgccgaagcaaccatttgttatacaggagatatccttgacccaagtcgaccaaaatat
aatatccaatactacaaagatttggcaaaagaattagaagctactggggctcatatactt
gccgttaaagatatggcgggcttgttgaaacctcaagcggcatatcgcttgatttctgaa
ttaaaagatacagttgacttaccaattcacttgcatacacatgatacttcaggaaatggt
attattacctattctggtgcaactcaagcaggagtagatattattgatgtggcaacggcc
agtcttgctggtggaacttctcaaccttcaatgcaatcaatttattatgcccttgaacat
ggtccccgtcatgcttcaattaatgtgaaaaatgcagagcaaattgaccactattgggaa
gatgtgcgtaaatattatgcaccttttgaggcaggaattacgagcccacaaacggaagtt
tacatgcatgagatgcctggcggacagtatactaacttgaaatctcaagcagcagctgtt
ggacttggacatcgttttgatgaaatcaaacaaatgtatcgtaaagtaaacatgatgttt
ggcgatatcattaaagtaactccttcatcaaaagtagttggtgatatggcactctttatg
attcaaaacgaattgacagaagaagatgtctatgcgcgaggaaatgagctcaacttccct
gaatcagtagtttcattcttccgtggtgatttaggtcagcctgttggcggctttccagaa
gaattacaaaaaattattgtaaaagacaaatcggtcattacggatcgtccaggattacat
gccgaaaaagttgattttgcaactgtaaaagctgacttggaacaaaaaattggttatgaa
ccaggtgatcatgaagttatctcttacattatgtatccacaagttttccttgattatcaa
aaaatgcaaagagaatttggagctgtcacactacttgatacgccaactttcttacacgga
atgcgtctcaacgaaaaaattgaagtccaaattgaaaaaggtaaaacgctcagcattcgt
ttagatgaaataggagaacctgacctcgctggaaatcgtgtgctcttctttaacttgaac
ggtcagcgtcgtgaagttgtgattaatgaccaatccgttcaaactcagattgtagctaaa
cgtaaggccgaaacaggtaatccaaaccaaattggagcaactatgcccggttctgttctt
gaaatcctagttaaagctggagataaagttaaaaaaggacaagctttgatggttactgaa
gccatgaagatggaaacgaccattgagtcaccattcgatggagaagttattgcccttcat
gttgtcaaaggtgaagccattcaaacacaagacttattgattgaaattgactaa

DBGET integrated database retrieval system