KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_0971Help
Entry
uc509_0971        CDS       T02415                                 

Gene name
fhs
Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
lli00670  One carbon pool by folate
lli01100  Metabolic pathways
lli01120  Microbial metabolism in diverse environments
lli01200  Carbon metabolism
Module
lli_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:lli00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    uc509_0971 (fhs)
Enzymes [BR:lli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     uc509_0971 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: AFW91534
Position
958560..960227
Genome map
AA seq 555 aa AA seqDB search
MKTDIEIAQAAEIQPITKIAEKIGLSFDDIELYGKYKAKIPLEVLEKFDEQTDGKLVLVT
SINPTPAGEGKSTVTVGLADAFARQDKNVMVALREPSLGPVMGIKGGAAGGGFAQVLPME
DINLHFTGDIHAITTANNAISAFLDNSLHQGNPLNIDPRRIIWKRVLDLNDRALRHVTIG
LGGPLNGVPREDGFDITVASEIMAVLCLATSISDLKERLARIVIAQNYDRKPVSVGDLGV
QGAIAMLLKDALKPNLVQTIEGTPALIHGGPFANIAHGCNSVLATKTALKLADIVITEAG
FGADLGGEKFLDIKTRQLGKQPDAVVVVATLRALKMHGGVDKKELTSENVEAVKKGFANL
ERHIKNMQSYGLPVIVAINQFASDTESEISTLKELTEALGVSVSLTQVFAKGGEGGLDLA
EKLSAMLQAKPDFRYLYELNQPLSVKLDKVVTEIYGGSKVNLSPKAKRQMREIEENGWNN
LPVCMAKTQYSFSDQANLLAAPEGFEVTVRELIPKIGAGFIVALLGDVMTMPGLPKNPAA
LKMDVTDDGKISGLF
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagatattgaaattgcccaagctgctgaaattcaaccaattactaaaattgcc
gaaaaaataggattatcttttgacgatattgaactttacgggaaatataaggctaaaatt
cccttagaagtgttagaaaagtttgatgaacaaaccgatgggaaattggttttagtaaca
tctattaaccctacaccagcgggtgagggtaaatcgacggtgacagtggggcttgctgat
gcctttgccagacaagataaaaatgtaatggttgctctacgagagccttctcttggtccg
gtcatgggaattaaaggtggagcagctggtggtggatttgctcaagttcttccaatggaa
gacattaatcttcattttacaggagatattcatgccattacaacggctaataacgcaatt
tcggcttttctggacaattcgcttcatcaagggaatcctttaaatattgacccacgaaga
attatctggaaacgtgtgcttgatttgaacgaccgtgctttacgtcatgtaacgattgga
ctgggaggaccgcttaatggggttcctcgtgaggatggttttgatattacagtggctagc
gaaattatggctgttctttgtctggcgacttctatcagtgatttgaaagagcgtttagca
agaattgtcatcgctcaaaattatgaccgtaaacctgtcagtgtcggagatttaggggtt
cagggggcaattgcaatgctcttaaaagatgcccttaaaccaaaccttgttcaaacaatt
gaaggaacaccagctttaattcacggtggaccttttgctaatattgcccatggatgtaat
tctgttttagcaacaaaaacagcacttaaattggctgatattgtcattacagaggcagga
tttggagctgaccttggtggtgaaaaatttttggatatcaagacacgtcagttagggaaa
caacctgatgctgtggtagttgtggctacgcttcgtgcgcttaagatgcacggtggcgtt
gataagaaagaattgacaagtgaaaatgtcgaggctgttaaaaaaggttttgctaatttg
gaacggcatatcaaaaacatgcaaagttatggcctgccagtgattgtagcgattaatcaa
tttgcatcggatacagagtcagaaatttcaactttaaaagaactgacagaagctttggga
gtttcagtttcactaactcaagtttttgctaaaggtggcgaaggtggtttagatttagct
gaaaaactgtcagcaatgttacaagcaaaacctgattttcgttatctttatgagctaaat
caacccttgtcagtaaaacttgacaaagttgtgacagaaatttatggcggttccaaagtt
aatttatctccgaaagctaagcgtcagatgagagaaattgaagaaaatggttggaataac
ttaccagtttgtatggctaaaacgcagtattcattttcagaccaagcgaatcttttagca
gctcccgaaggctttgaggttacagtgcgtgagctgattccgaaaatcggtgctggattt
attgttgctcttttaggagatgtgatgacaatgccaggtctgcccaaaaatcctgctgct
ttaaaaatggacgtgactgatgatggtaaaatctcaggattattttag

DBGET integrated database retrieval system