KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_1342Help
Entry
uc509_1342        CDS       T02415                                 

Definition
(GenBank) 23S rRNA m(1)G 745 methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Brite
KEGG Orthology (KO) [BR:lli00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lli03009]
    uc509_1342
Enzymes [BR:lli01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     uc509_1342
Ribosome biogenesis [BR:lli03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    uc509_1342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Ubie_methyltran Methyltransf_23 Methyltransf_32 Methyltransf_9 Methyltransf_12 MTS FtsJ Methyltransf_8 Methyltransf_4 Pico_P2B MetW AdoMet_MTase
Motif
Other DBs
NCBI-ProteinID: AFW91845
Position
1333838..1334653
Genome map
AA seq 271 aa AA seqDB search
MSEIIKCPVCNHLLSKEGNTFKCENNHTFDLAKEGYLNLLLNAKKTSGDSKEMMAARRDF
LAKGYYEKLSDRVNQRLNNLSSTNQTIVDIGCGEGYYLSRFQKEMAPESTKLYGMDISKL
GIRMAAKKNTTIQWLVANFANLPFTDKSVSTVLSMFAEYSVPEIDRILTDGGNIIIVRAA
SDHLIELKNIIYPEIHEKVKASSIKTFPGFLVEQENYSYQVTIQSTEDLLSLLLMTPHYW
KIKPEGIENLKKFEALEVTISIEIDVLKRQK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaattataaaatgtcctgtttgcaatcatttactttcaaaagaaggaaatact
tttaaatgtgagaataatcatacttttgatttggctaaagaaggctatcttaaccttctt
ttaaatgccaaaaaaacttctggcgactcaaaagaaatgatggcagccagacgtgatttt
ctcgcaaaaggttattatgaaaaactatccgaccgagtcaatcaacgcttaaacaattta
tcttcaaccaaccaaaccattgtcgacattggttgtggggaaggttactatctttcacgt
ttccaaaaagaaatggcaccagaatccactaagctttatggaatggatatttctaagctc
gggattcggatggctgctaaaaaaaacacaacgattcaatggttagtagccaattttgcc
aatctcccttttactgacaagtccgtcagtactgttttatccatgttcgcagaatattct
gtcccagaaattgaccgaattctgactgacggaggaaatattatcatcgtcagagccgct
agcgaccacctcattgaattaaaaaatattatctatcctgaaattcatgaaaaagttaaa
gcctcttctattaaaactttccctggctttttagttgagcaagaaaattattcttatcaa
gtgacaatccaatccacagaagatttattaagcttactactgatgacccctcattattgg
aaaatcaaaccagagggaattgaaaatctcaaaaagtttgaagctttagaagtaacaatc
agtattgaaattgatgtattaaagcgacaaaaataa

DBGET integrated database retrieval system