KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_1525Help
Entry
uc509_1525        CDS       T02415                                 

Gene name
mvaA
Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
lli00900  Terpenoid backbone biosynthesis
lli01110  Biosynthesis of secondary metabolites
lli01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lli00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    uc509_1525 (mvaA)
Enzymes [BR:lli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     uc509_1525 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AFW92004
Position
complement(1511534..1512775)
Genome map
AA seq 413 aa AA seqDB search
MGNMRKKFYQMSPQERLNSLNLSEKSQEILSEMALDTTILDNLIENQISEFELPMGIAQN
FVINGQSFLIPMVTEEPSVIAAASNGAKIAGNFVAEIKERLMRGQIVFYDVKNSDKIANE
ILEKQEKIFEQAELSYPSIVKRGGGLREVSSRIFSSQKFLSVDVKVDVKDAMGANIINSI
LEGIAELFRRWFPDEKILFSILSNYATESLVKVTCEIPVERLSKKADGYEIGQKIMAASQ
YSKIDPYRASTHNKGIMNGINAVILATGNDTRAISAAIHAYAAKDGAYQGLANWELQEKM
LVGELEIPLPVATVGGGVKVLPKAQAAMEILGIRDAKELAKVIAAVGLAQNLAALRALVS
EGIQQGHMSLQARSLALSVGAQADEIAILSQQLRKEKVMNQEVAQNLLKNLRK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
ttgggaaatatgagaaaaaaattttatcaaatgtcgccacaagagcgattgaattcgtta
aacttatccgaaaagagtcaagaaattttaagtgagatggccctagatacaactattttg
gacaatctcatagaaaatcaaatttctgaatttgaattgccaatgggaattgcccaaaat
tttgttattaatggacaaagttttctaataccaatggttacagaggaaccgtcagtaatt
gccgcagcaagtaatggagcaaaaatagctggaaattttgtagctgaaattaaagaacgt
ttaatgcgtggtcaaattgtattttatgatgttaaaaattcagataagattgcaaatgaa
atacttgaaaagcaagaaaaaatctttgaacaagccgaactttcttacccttcaatcgtt
aaacgaggtggcggtttgagagaggtttctagtcggattttctctagtcaaaagttttta
tctgttgatgtcaaggttgatgttaaagacgccatgggtgcaaatattattaattcaatc
ttagagggaattgctgaactctttcggaggtggtttcctgatgaaaaaattctgtttagt
attttatcaaattatgctactgaatcactagtgaaagtgacctgtgaaattccggttgaa
cgcctttcaaaaaaagcagatggatatgaaattggtcaaaaaattatggctgcttcccaa
tattcaaaaattgatccttatcgtgctagtacccataacaaagggattatgaacggtatc
aatgcggtcattttagctacaggaaatgatactcgggccatctcagctgctattcatgct
tatgcggcaaaagatggagcctaccaagggttagccaactgggaacttcaagagaaaatg
ttagttggcgaactcgaaattcctttaccagtggcaactgtcggagggggagtcaaggtt
ttgccaaaagcacaagcggccatggagattctgggtatcagggatgctaaggagctcgca
aaagttattgctgcagtgggactagctcaaaacttagccgctttacgtgccctagtttca
gaaggaattcaacagggacacatgagtctacaagctcgttctttggctttgagtgtagga
gcacaagcggatgaaatcgcgatattaagtcaacaattgcgcaaagaaaaagtgatgaat
caagaagtagcccaaaatttactaaaaaatttgagaaaataa

DBGET integrated database retrieval system