KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_1526Help
Entry
uc509_1526        CDS       T02415                                 

Gene name
thiL
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
lli00071  Fatty acid degradation
lli00072  Synthesis and degradation of ketone bodies
lli00280  Valine, leucine and isoleucine degradation
lli00362  Benzoate degradation
lli00380  Tryptophan metabolism
lli00620  Pyruvate metabolism
lli00630  Glyoxylate and dicarboxylate metabolism
lli00640  Propanoate metabolism
lli00650  Butanoate metabolism
lli00900  Terpenoid backbone biosynthesis
lli01100  Metabolic pathways
lli01110  Biosynthesis of secondary metabolites
lli01120  Microbial metabolism in diverse environments
lli01130  Biosynthesis of antibiotics
lli01200  Carbon metabolism
lli01212  Fatty acid metabolism
lli02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    uc509_1526 (thiL)
   00630 Glyoxylate and dicarboxylate metabolism
    uc509_1526 (thiL)
   00640 Propanoate metabolism
    uc509_1526 (thiL)
   00650 Butanoate metabolism
    uc509_1526 (thiL)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    uc509_1526 (thiL)
   00072 Synthesis and degradation of ketone bodies
    uc509_1526 (thiL)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    uc509_1526 (thiL)
   00310 Lysine degradation
    uc509_1526 (thiL)
   00380 Tryptophan metabolism
    uc509_1526 (thiL)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    uc509_1526 (thiL)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    uc509_1526 (thiL)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    uc509_1526 (thiL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lli04147]
    uc509_1526 (thiL)
Enzymes [BR:lli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     uc509_1526 (thiL)
Exosome [BR:lli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   uc509_1526 (thiL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AFW92005
Position
complement(1512814..1513953)
Genome map
AA seq 379 aa AA seqDB search
MKEIVIIDALRTPVGKYDGALAEYSAEKLGTHVVSALLSKNKNIKSDVEQVIFGNVLQAG
NGQNIARQIAINSGLSTSVPASTINEVCGSGMKAVILAKQLLQLGEAEVVIAGGTESMSN
APILKNRNTEEETLSMLSDGLIDAFSGISMGIIGETIAEQFDVSRADQDRFAQNSQEKAV
AASQAGIFNDEIVALGELSVDETPRPSSSLEKLATLRTAFKENGTVTAGNSSPVNDGASA
LILATKDYAEKHGISYLAELVESAEVGIDPAIMGVSPIDAIQKLVQRSGVQLSEIDLFEI
NEAFAASSIAVNRELGLKDSQVNIYGGAIALGHAIGSSGAKILTTLGYALKREQKRYGIA
SLCIGGGLGLAILLKNPDF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaaattgtaatcattgacgccttaagaacaccagtcggaaaatatgatggtgct
cttgctgagtattcggcagaaaaacttggaacacacgttgtttcagctttattgtcaaaa
aataaaaatataaaatcagatgttgaacaagttatttttggtaatgttcttcaagctggt
aatggtcaaaatattgcgcgccaaattgcgattaatagtggtttatcaaccagtgttcca
gcttcaaccattaatgaagtttgtggttcaggaatgaaggcagtaattctagctaagcaa
cttttacagttgggcgaagcagaagttgttattgctggtggaacggaatcaatgtctaat
gcgcctattcttaaaaatcgtaatacagaagaagaaacattaagcatgttaagtgacggc
ttaattgatgctttttctggcatttcaatgggaattattggagaaacaattgcggagcag
tttgatgttagtcgtgctgaccaagaccgattcgcacaaaattctcaagagaaggcagta
gcagccagtcaagcaggaatttttaatgacgagattgtagctcttggggaactttctgtt
gatgaaactcctcgaccttcatctagcttggaaaaattggctacattacggacagccttt
aaggaaaatggaacagttacagctgggaattcttcaccagttaatgacggagcttctgct
ttaattttggctactaaagattacgctgaaaagcatgggatttcttatttagctgaatta
gttgagagtgcggaagttggtattgaccctgcaattatgggagtatcaccgattgatgca
attcaaaaattagttcaacgctcaggcgttcagctttcagaaatagatctttttgaaatt
aatgaggcctttgctgcatcaagtattgctgttaatcgtgaattgggcttaaaagattct
caagttaatatttacggaggagcgattgctcttggacatgctattgggtcaagtggtgcc
aaaatcctgacaactttgggatatgctttgaaacgtgaacaaaagcgttatggaattgct
agtctttgtattggcggtggtctagggcttgctattttattgaaaaatcctgacttttaa

DBGET integrated database retrieval system