KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_1733Help
Entry
uc509_1733        CDS       T02415                                 

Gene name
tenA
Definition
(GenBank) transcriptional activator TenA
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
lli00730  Thiamine metabolism
lli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lli00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    uc509_1733 (tenA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lli03000]
    uc509_1733 (tenA)
Enzymes [BR:lli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     uc509_1733 (tenA)
Transcription factors [BR:lli03000]
 Prokaryotic type
  Other transcription factors
   Others
    uc509_1733 (tenA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: AFW92189
Position
complement(1727915..1728571)
Genome map
AA seq 218 aa AA seqDB search
MLFTELAREKSAKYWEMSFEHPFIEGLVTGNLSSDVFRYYLLQDRYYLEHFSKLYLYIAE
KTEDKMIREHLKLNAEELKEGEIFIREGFFRDLDITEQEISETAIAPTAYHYVSHMYRQL
VDGTVNTAIAGMLPCAWLYHEIGLRLIDRGSSNALYQRWIETYASEEAAAQIEKECAIIN
QLYQESNESEREKMLEAFVISSKMEYEFWEMSMNLEKW
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgttatttactgaattagcaagagaaaagtcagcaaaatattgggaaatgagttttgaa
cacccttttatcgaaggtttagtgacggggaacttatcttctgatgttttccgatattac
ttacttcaagatcgctattatttagagcactttagtaagctctatctttatattgcggaa
aaaactgaggataaaatgattcgagaacatttaaaattaaatgcagaagaattaaaagaa
ggtgaaatattcattcgagaaggtttttttagggacttagacattaccgagcaagaaatt
tcagaaaccgctattgctccaactgcttatcattatgtttctcatatgtatcgtcagctc
gttgatggtacggttaatacggctattgctggaatgttgccttgcgcttggctttatcat
gagattggacttcgtttgattgataggggttcttctaacgccttataccaacgatggatt
gaaacatacgcgagtgaagaggctgcggcacaaatcgaaaaagagtgtgccattatcaat
caactttatcaagaaagtaatgagtcagaacgtgaaaaaatgcttgaagcttttgtgatt
agcagtaagatggaatacgaattttgggaaatgtcgatgaacttagaaaaatggtaa

DBGET integrated database retrieval system