KEGG   Lactococcus lactis AI06: LG36_0778Help
Entry
LG36_0778         CDS       T03480                                 

Gene name
metS
Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
llj  Lactococcus lactis AI06
Pathway
llj00450  Selenocompound metabolism
llj00970  Aminoacyl-tRNA biosynthesis
llj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LG36_0778 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LG36_0778 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:llj01007]
    LG36_0778 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:llj03016]
    LG36_0778 (metS)
Enzymes [BR:llj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LG36_0778 (metS)
Amino acid related enzymes [BR:llj01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LG36_0778 (metS)
Transfer RNA biogenesis [BR:llj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LG36_0778 (metS)
 Prokaryotic type
   Other AARSs
    LG36_0778 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AIS03378
Position
839085..841073
Genome map
AA seq 662 aa AA seqDB search
MTENKTFYITTPIYYPSGKLHLGSSYTTIACDVLARYKRLMGFDTFYLTGLDEHGMKIQR
KAEELGMTPKEYLDPMAADVQELWKKLDISYDKFIRTTDTYHEEAVAKAFEQLLEQDDIY
LGKYAGWYSVSDEEFFTETQLEEIFRDESGNITGGIAPSGHEVEWVEEETYFFRMGKYAD
WLLQYYDEHPDFIQPEVRKNEMVNNFIKPGLEDLALTRTSFTWGIPVPSNPKHVVYVWFD
ALLNYITALGYNSDNDSNFKKYWPGINMVGKEIVRFHTIYWPIMLHALGLPAPKKIFGHG
WLLMKDGKMSKSKGNVVYPEMLIERYGLDAVRYYLMRAISFGQDGIFTPEDFVGRINFDL
ANDLGNLLNRTVSMINKYNDGKIEATGVSTEFDASLEEVVEETISHFHKAMDKFEFNVAL
ADVWTLISRTNKYIDETAPWVLAKSEDDKAKLNNVLYHLAENLRIAGALLQPFMRATSGK
IFEQLGMDERSFSLETLAFGYSFTHPVVAKGQPIFPRLDVEEEVAYIKLQMAGGVLPEKE
WVPEEVELNLTLPQIKFDDFEKIELKVAEVLEVEPVEGSDKLLRFKLDAGDSEPRQILSG
IAQFYPNEQELVGKKLQIVANLKPRKMMKKYVSQGMILSAEFDGKLRVLTVDDDVPAGSL
IG
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaataaaactttttacattacaaccccaatttattatccatcaggtaagttg
catcttggtagttcttacacaactattgcttgtgacgtgcttgctcgttacaaacgtttg
atgggctttgatactttttatttaacagggcttgatgaacacggaatgaaaattcaacga
aaagccgaagaattgggaatgactcctaaagaatacttggacccaatggcggctgatgtt
caagaattatggaaaaaattggatatttcttatgataaatttattcgtactacagacact
tatcatgaagaagccgtagcgaaggcttttgaacagttattggaacaagatgatatttat
ttgggaaaatatgcgggttggtattctgtttctgatgaagagtttttcactgaaacacaa
cttgaagaaattttccgagatgaatctggaaatattactggtggtattgcaccttctggt
catgaagtggaatgggttgaagaagaaacttatttcttccgcatgggaaaatatgctgac
tggcttttacaatattatgatgaacatccagattttattcaacctgaggttcgtaaaaat
gaaatggtcaataatttcatcaagccaggtctagaagatttggctttgacacggacaagt
tttacttggggaattcctgtcccttctaatcctaagcatgtggtctacgtgtggtttgat
gctttattgaactatattacagcgctcggctataattctgacaatgacagtaattttaaa
aaatactggcctggaattaatatggttggtaaagaaattgttcgtttccatacgatttac
tggccaattatgcttcatgctctaggtttacctgctcctaaaaagattttcggacatgga
tggctcttgatgaaagacggaaaaatgtctaaatcaaaaggaaatgttgtttatcctgag
atgttgattgaacgttatggtcttgatgcggttcgttattatttgatgcgtgcgatttct
tttggacaagatggaattttcactccagaagactttgttggacggattaattttgatttg
gccaatgatttggggaatttgttgaatcgtaccgtttcaatgattaacaaatataatgac
ggaaaaatcgaagcaactggagtttcgactgaatttgatgcaagtttagaagaagtggtt
gaagaaacaatcagtcatttccataaagcaatggataaatttgaattcaacgtggctttg
gctgatgtttggacattgatttcaagaacaaataaatatattgatgaaacagcaccttgg
gtccttgcaaaatcagaagacgacaaagcaaaattgaataatgttttgtatcatttggca
gaaaatttacggattgcaggtgcacttttacaaccatttatgcgtgcaacatcaggtaaa
atctttgagcaattgggaatggatgaaagatcattttcacttgaaactcttgcttttggc
tattcatttacccatcctgtagtagcaaaaggtcaacctattttcccacgtcttgatgtg
gaagaagaggttgcttatattaaattacaaatggctggtggcgtattgccagaaaaagag
tgggtccctgaagaagttgaattgaatttaactttaccacaaattaaatttgatgatttt
gaaaaaattgaattaaaagttgccgaagtgcttgaagtagaacctgttgaaggttctgat
aaattgttgagatttaaattggatgctggtgattctgaaccacgtcaaatcttgtcagga
attgcacaattttatccaaatgaacaagaattagtaggtaaaaaattacaaatcgtagcc
aatttgaaaccacgtaaaatgatgaaaaaatacgtttcacaaggaatgattttgtcagcc
gaatttgatggaaaattgcgtgtcttgaccgttgatgatgatgttcctgctggttcattg
atcgggtaa

DBGET integrated database retrieval system