KEGG   Lactococcus lactis AI06: LG36_1023Help
Entry
LG36_1023         CDS       T03480                                 

Gene name
gpo
Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
llj  Lactococcus lactis AI06
Pathway
llj00480  Glutathione metabolism
llj00590  Arachidonic acid metabolism
llj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    LG36_1023 (gpo)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LG36_1023 (gpo)
Enzymes [BR:llj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LG36_1023 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AIS03620
UniProt: A0A2A9IMR2
Position
1108179..1108652
Genome map
AA seq 157 aa AA seqDB search
MNFYDFSAVKMNGETVSMSDFKGKVVIVVNTASKCGFTPQFEGLEKLYENYKDQGLEILG
FPCNQFANQDAGENSEINEFCQLNYGVTFPMFQKIKVNGKEAHPLYQFLKKEAKGALSGT
IKWNFTKFLIDREGNVIERFAPKTEPKEMEEEIQKLL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttatgattttagtgccgttaaaatgaacggcgaaactgtttcaatgtctgat
tttaaaggcaaagttgtaattgtggtcaacactgcaagtaaatgtggctttacaccgcaa
tttgaaggacttgaaaagttgtatgaaaactataaagaccaaggattggaaattttaggt
tttccctgtaatcaatttgcaaatcaagacgctggcgaaaattcggaaatcaatgaattt
tgtcaattaaattatggggtcactttccccatgtttcaaaaaattaaagtcaatggtaaa
gaagcacatcccctttatcaatttttgaaaaaagaagcaaaaggggcacttagcgggacc
attaaatggaatttcacaaaatttttaattgaccgagaaggaaatgttattgaacgtttt
gcaccaaaaacggaacctaaagaaatggaagaagaaatccaaaaattactttaa

DBGET integrated database retrieval system