KEGG   Lactococcus lactis AI06: LG36_1284Help
Entry
LG36_1284         CDS       T03480                                 

Gene name
nucA
Definition
(GenBank) 5'-nucleotidase
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
llj  Lactococcus lactis AI06
Pathway
llj00230  Purine metabolism
llj00240  Pyrimidine metabolism
llj00760  Nicotinate and nicotinamide metabolism
llj01100  Metabolic pathways
llj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LG36_1284 (nucA)
   00240 Pyrimidine metabolism
    LG36_1284 (nucA)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    LG36_1284 (nucA)
Enzymes [BR:llj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     LG36_1284 (nucA)
CD molecules [BR:llj04090]
 Proteins
  LG36_1284 (nucA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:llj00537]
 Enzymes
  LG36_1284 (nucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YmdB
Motif
Other DBs
NCBI-ProteinID: AIS03881
Position
complement(1413418..1414164)
Genome map
AA seq 248 aa AA seqDB search
MKLSILHVNNTHLTLDKDFSLINKIKEKNKKRVIETLVLGDGNSIFNNIGHKNDEQNLLN
TFPFDATTLGSHQFDEGSKGIVENLNKINFPILAANVNFENDKLLNPLVKEGKFVPYLLK
NTASGRKIGIFGLTTMDIVYRSHPSAETIFSNPFDKADFIVKRLKKLEVDVIILLSQLGE
EMNQMLAQEFLEIDIIIDKHVGTSGKKVEKCGNTLIIQSETDNYSLIESEINIDNEGNLL
FIQENNYI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttagcattttacatgtaaataatactcatctcacccttgataaggatttttct
ttaattaataaaatcaaagaaaagaataaaaaaagagtcatagaaactttagttttggga
gatggaaatagcatttttaataacattgggcacaaaaatgatgaacaaaacctcctgaat
acctttccttttgatgcgacgacattgggaagtcatcaatttgatgagggttcaaaagga
atagtggaaaatttaaataaaataaattttccaattttagccgctaatgttaattttgaa
aatgataaacttttaaatcctttagtaaaagaaggaaaatttgttccttatcttcttaaa
aatacagcatcaggtaggaaaataggaatatttggtttgacaacaatggatattgtttat
cgctcacatccgagtgcggagactattttttctaacccttttgataaggcagattttata
gttaaaagattaaaaaaacttgaagttgatgttattattttattaagtcaacttggagaa
gaaatgaaccaaatgttagctcaagaatttttagaaattgatattattatcgataaacac
gtagggacatcaggaaaaaaagttgaaaaatgcggaaatacactcattattcaatctgaa
actgataactattctcttatagaatctgaaatcaatattgataacgaaggcaatttactt
tttattcaagaaaataattatatttga

DBGET integrated database retrieval system