KEGG   Lactococcus lactis AI06: LG36_1429Help
Entry
LG36_1429         CDS       T03480                                 

Gene name
butB
Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
llj  Lactococcus lactis AI06
Pathway
llj00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:llj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LG36_1429 (butB)
Enzymes [BR:llj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     LG36_1429 (butB)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     LG36_1429 (butB)
    1.1.1.-  
     LG36_1429 (butB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox_2 HI0933_like DAO 2-Hacid_dh_C 3HCDH_N ADH_zinc_N_2 AlaDh_PNT_C UDPG_MGDP_dh_N NAD_binding_8 FAD_binding_3 Pyr_redox Pyr_redox_3 RrnaAD FAD_oxidored XdhC_C
Motif
Other DBs
NCBI-ProteinID: AIS04024
Position
complement(1568182..1569252)
Genome map
AA seq 356 aa AA seqDB search
MRAARFYDRGDIRVDEIKEPIVKAGQVGIDVAWCGICGTDLHEFLDGQFFCPSTEHPNPI
TGEVPPVTLGHEMSGVVNFIGEGVSGLKVGDHVVVEPYIVPEGTDTSETGHYNLSEGSNF
IGLGGNGGGLAEKISVDERWVHKIPDNLPLDEAALIEPLSVGYHAVERANLSEKSTILVV
GAGPIGLLTAAVAKAQGHTVIISEPSDFAAKKAQEAQVADYFFNPIEDDIQAKVHEINEK
GVDAAFECTSVQPGFDACLDAIRMGGTVVIVAIWGKPASVDMAKLVIKEANLLGTIAYNN
THPKTIDLVSTGKIKLDQFITAKIGLDDLIDKGFDTLIHHNETAVKILVSPTGKGL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagcacgtttttatgaccgcggggatatccgcgttgatgaaattaaggaacca
atagtaaaagctggtcaagttggcattgatgtggcttggtgtggaatttgtggaacagat
cttcatgaatttttagatggccaatttttttgtccgtcaacagaacatcctaatccaatt
actggagaagtaccaccagtcactcttggacatgaaatgtctggggttgtaaattttata
ggtgaaggagtaagcggacttaaagtaggtgaccatgtcgttgtcgaaccttatatcgtt
cccgaagggactgatacaagtgaaactggacattataacctctcagaaggttcaaacttt
attggtttgggtggaaatggcggaggtttggctgaaaaaatttctgttgatgaacgttgg
gttcacaaaattcctgataacttaccattggatgaagccgctctaattgaaccactatca
gttggctaccacgctgttgaacgggcaaatttaagtgaaaagagtacgatattagttgtt
ggtgctggaccaattggacttttaactgctgccgttgcaaaagcgcaaggacatactgtt
atcatcagtgaacctagtgacttcgccgcaaaaaaggcacaagaagcacaagttgctgat
tatttcttcaatccaattgaagatgacattcaagctaaggttcatgaaattaatgaaaaa
ggagtggacgcagcctttgaatgtacctctgtccaaccgggatttgacgcttgtctagat
gcgattcgtatgggtggaacagttgtcattgttgcaatttggggtaagcctgctagtgtt
gatatggcaaaattagtaatcaaagaagctaatcttttaggaacgattgcttataataac
actcatccaaaaacaattgatttagtatcaacaggtaaaataaaattggaccaattcatc
acagctaaaatcggtttggatgatttaattgataaaggatttgatacgctgattcatcat
aatgaaacagctgttaaaattttagtttcacccactggtaaaggtctataa

DBGET integrated database retrieval system