KEGG   Lactococcus lactis AI06: LG36_1738Help
Entry
LG36_1738         CDS       T03480                                 

Gene name
fadA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
llj  Lactococcus lactis AI06
Pathway
llj00071  Fatty acid degradation
llj00072  Synthesis and degradation of ketone bodies
llj00280  Valine, leucine and isoleucine degradation
llj00362  Benzoate degradation
llj00380  Tryptophan metabolism
llj00620  Pyruvate metabolism
llj00630  Glyoxylate and dicarboxylate metabolism
llj00640  Propanoate metabolism
llj00650  Butanoate metabolism
llj00900  Terpenoid backbone biosynthesis
llj01100  Metabolic pathways
llj01110  Biosynthesis of secondary metabolites
llj01120  Microbial metabolism in diverse environments
llj01130  Biosynthesis of antibiotics
llj01200  Carbon metabolism
llj01212  Fatty acid metabolism
llj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:llj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LG36_1738 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    LG36_1738 (fadA)
   00640 Propanoate metabolism
    LG36_1738 (fadA)
   00650 Butanoate metabolism
    LG36_1738 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LG36_1738 (fadA)
   00072 Synthesis and degradation of ketone bodies
    LG36_1738 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LG36_1738 (fadA)
   00310 Lysine degradation
    LG36_1738 (fadA)
   00380 Tryptophan metabolism
    LG36_1738 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LG36_1738 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LG36_1738 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LG36_1738 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:llj04147]
    LG36_1738 (fadA)
Enzymes [BR:llj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LG36_1738 (fadA)
Exosome [BR:llj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LG36_1738 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIS04333
Position
1902640..1903788
Genome map
AA seq 382 aa AA seqDB search
MSFKNPVGIITANRLPIGKINGFYKKISPETLYQNLIKQQFNKNPLLKKADIDYIILGNV
TNQGGNLARRCALKAGFSSNIPAFTIDQQCGSGLTAMISSANYIISGEASIICTGGVEST
SQANIVLDSESHQPINRFKMAPDPYEDFDMGTIADMSALKYNISRSIQDLYALNSHKKAT
QAIEGKLLENEIFPYQDEEFTISSDQTVRPKSSIEDLSKLTPAFTTNGTATAGNSCPIND
GASSIILSSTNNPFDFQGYYLGQTTVALSPSDFLLGPIKATEKLLQKFSLKLNDIEAIEL
NEAFASQAILFQNYFKLDDIKLNAYGGALAFGHPYGATGGILISRLLNRLNQVQKPCLGI
ATLCVAGGMGISVLIGNHWYQK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaaaaatcccgtcggtattataacagcaaaccgtttacctataggaaaaatc
aatggtttttataaaaaaatttctcctgaaactttatatcaaaatctaattaaacaacaa
tttaataaaaatccccttctcaaaaaagctgatattgactatattattttgggaaatgtg
actaaccaaggaggaaatttagctcgacgttgcgctttaaaagcaggattctcgagcaac
atcccagcttttacaattgaccagcagtgcggttctggactgacagctatgattagctct
gcaaattacattatttctggtgaagcttccattatttgtacaggaggggtagaaagcaca
tctcaagccaatatcgtacttgattcagagagtcatcagccgattaaccgatttaaaatg
gctcctgacccctatgaagattttgacatgggaacaattgccgatatgtcagccctaaaa
tacaatatttctcgtagtattcaagacctttacgctctaaatagtcataaaaaagcgact
caagccattgaaggaaaacttttagaaaatgaaatttttccctatcaagatgaagaattt
acaataagtagtgatcaaactgttcgccctaaatcctcaatagaagatttgagcaaatta
acccctgcttttaccactaacggaacagccactgctggaaactcttgtccaataaacgac
ggtgcttcttcaatcatattgtcatccactaataacccttttgattttcaaggctattat
ttaggacaaacaactgttgctttatctccatcagatttcttattaggcccaataaaagca
actgaaaaacttttacagaaattttcccttaaacttaatgatattgaggctatcgaatta
aatgaagcatttgccagtcaagccattttattccaaaattattttaagcttgatgatata
aaattaaatgcttatggtggtgcccttgcatttggtcatccttacggtgcaactggtggc
attctaatttctcgactcttaaatcgcctaaatcaagtgcaaaaaccatgtcttggcatc
gcaactttgtgcgtagctggaggtatgggaatcagtgtactgataggtaatcactggtat
caaaaatga

DBGET integrated database retrieval system