KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_0279Help
Entry
LLKF_0279         CDS       T01141                                 

Gene name
ymgH
Definition
(GenBank) Hypothetical protein
Organism
llk  Lactococcus lactis subsp. lactis KF147
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2273 SpoVAB
Motif
Other DBs
NCBI-ProteinID: ADA64061
UniProt: D2BMN6
Position
277461..277649
Genome map
AA seq 62 aa AA seqDB search
MDYFEKNRYPIIGGIVGALIAVCIFTIGFWKMILVLFLIGLGIYIGLFLKKSGIIDQFID
RK
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atggattatttcgaaaaaaatcgatacccgattatagggggaatcgtaggtgcactcatt
gctgtgtgtatcttcactattggattttggaaaatgattttggttttatttttaattgga
ttaggaatttatattggtctattcttaaaaaaatcaggaatcattgatcaatttatagat
cgtaaataa

DBGET integrated database retrieval system