KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_0551Help
Entry
LLKF_0551         CDS       T01141                                 

Gene name
dfpA
Definition
(GenBank) Phosphopantothenoylcysteine decarboxylase
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
llk00770  Pantothenate and CoA biosynthesis
llk01100  Metabolic pathways
Module
llk_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:llk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    LLKF_0551 (dfpA)
Enzymes [BR:llk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     LLKF_0551 (dfpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein UPF0515
Motif
Other DBs
NCBI-ProteinID: ADA64317
UniProt: D2BP42
Position
complement(559034..559570)
Genome map
AA seq 178 aa AA seqDB search
MTKITLAVTGSIAAYKAADLTSLLTKEGHDVTVLMTKSATQFITPLTLQVLSKNKVHLDI
MDEERPELVNHIDLAKNTELFLVAPATADTISRLAQGRADDIVTSVALALEPSVPKYFAP
AMNTKMYQHPLTQKNIEILKKIDYNMIQPKKSLLACGDFGEGALADLPDILSDLKNSL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaattacacttgcggtaacaggttcaattgcagcttacaaagcagcagattta
acttctttactgacaaaagagggacatgatgtgacagttttaatgacaaaaagcgctact
cagttcatcactcctttaactctacaagttttgtccaaaaataaggttcacttggatatt
atggacgaagaacgtcctgaattggttaatcatattgatttagctaaaaatactgagctt
ttccttgttgcacctgcaactgctgatacaattagccgtttggcgcaaggccgagctgat
gatattgtcacttctgtagcccttgctcttgaaccttctgtaccaaaatattttgcccct
gcaatgaatactaaaatgtatcaacatcctttgacgcaaaaaaacattgagattcttaag
aaaatagattataatatgattcaaccgaaaaaatctttgctcgcttgtggagattttggt
gagggagcactcgccgacttacctgatattctatcggatttaaaaaattctttataa

DBGET integrated database retrieval system