KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_0747Help
Entry
LLKF_0747         CDS       T01141                                 

Gene name
menC
Definition
(GenBank) O-succinylbenzoate synthase
  KO
K02549  O-succinylbenzoate synthase [EC:4.2.1.113]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
llk00130  Ubiquinone and other terpenoid-quinone biosynthesis
llk01100  Metabolic pathways
llk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    LLKF_0747 (menC)
Enzymes [BR:llk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     LLKF_0747 (menC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-ProteinID: ADA64482
UniProt: D2BPK7
Position
complement(763322..764425)
Genome map
AA seq 367 aa AA seqDB search
MIIEKITMFHVQLPMKFNFKTAKGSLNLRDTIIIKVESPNGLSGFGEVVAFTTPFYTSET
FADSWKILEETYLPEILQKEFSHPFEIHEFFRNPLPMALAGLENALLDLYFKERNKNLIA
GLFQEKLADKIPRGAVLGQMSDEQTIKEIDQLINSGVKRIKLKISPQIGTDLIKKLVKRY
PQITFALDANRSFQLTDWPVIKELDELGLACIEEPFDIKDLSELKLLTENFLTPICFDES
VQDLESLKILTELPFQTMLNVKIGRLGGLYQTQKAIEFCRQHQIGFWIGSMVESGISKIL
HVQLAALSGNAMAGDLSDSKHYFDIDLIQPEIAFPNGWMTVPTGIGIGLSVNEVALDHYT
VNKEIFQ
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgataattgaaaaaattacaatgtttcatgttcaactccctatgaaatttaattttaag
accgccaaaggttccttaaatctccgagatacaattattataaaagttgaaagtcctaac
ggactttcgggatttggtgaggttgttgctttcacgactcctttttatacttcagaaact
tttgctgattcttggaaaatcttggaagaaacttacctgccagaaattttgcaaaaagaa
ttctcacacccttttgaaatacatgaattttttagaaatcccttaccaatggcactggcc
ggactagaaaatgcacttctagatttgtattttaaagaaagaaataaaaatttgattgct
ggactttttcaagaaaaattagctgataaaatcccacgtggtgcggtgcttggacaaatg
tctgacgagcaaaccattaaggaaattgaccaacttattaacagtggcgtcaaaagaatt
aaattaaaaattagtccacaaattgggactgatttgattaaaaagctggtaaaaagatat
ccacaaattacatttgctcttgatgccaatcgaagttttcaactgacagactggccagtc
atcaaagagctagacgaacttggtctggcttgtatcgaagaaccttttgatatcaaagat
ttatccgaattaaaattactgacagaaaacttcttaacaccaatttgctttgacgaatcc
gttcaagatttagaaagtctaaaaatactgacagaacttccttttcaaacgatgctcaat
gtaaaaataggtcgtttaggtggactttatcaaacgcaaaaagctatcgaattttgcaga
cagcatcagattggcttttggattggcagtatggttgagtctggtatctcaaaaatactc
catgtccaactcgctgcgctttctggaaatgctatggccggtgatttatccgattctaag
cattattttgacatagacctcattcaaccagaaattgcattcccaaatggctggatgacc
gtcccgactggaattggtatcggtctgtcagttaatgaagtcgcgctagatcactatact
gtaaataaggagattttccaatga

DBGET integrated database retrieval system