KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_0924Help
Entry
LLKF_0924         CDS       T01141                                 

Gene name
butB
Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
llk00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:llk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LLKF_0924 (butB)
Enzymes [BR:llk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     LLKF_0924 (butB)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     LLKF_0924 (butB)
    1.1.1.-  
     LLKF_0924 (butB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C Pyr_redox_2 AlaDh_PNT_C HI0933_like FAD_binding_3 DAO RrnaAD Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ADA64648
UniProt: D2BQ23
Position
953045..954115
Genome map
AA seq 356 aa AA seqDB search
MRAARFYDRGDIRVDEINEPIVKAGQVGIDVAWSGICGTDLHEFLDGPIFCPSAEHPNPI
TGEVPPVTLGHEMSGVVNFIGEGVSGLKVGDHVVVEPYIVPEGTDTSETGHYNLSEGSNF
IGLGGNGGGLAEKISVDERWVHKIPDNLPLDEAALIEPLSVGYHAVERANLSEKSTVLVV
GAGPIGLLTAAVAKAQGHIVIISEPSGLRRKKAQEAQVADYFFNPIEDDIQAKVHEINEK
GVDAAFECTSVQPGFDACLDAIRMGGTVVIVAIWGKPASVDMAKLVIKEANLLGTIAYNN
THPKTIDLVSTGKIKLDQFITAKIGLDDLIDKGFDTLIHHNETAVKILVSPTGKGL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagcacgtttttacgaccgcggggatatccgcgttgatgaaattaatgaacca
atagtaaaagctggccaagttggcattgatgtggcttggagtggaatttgtggaacagat
cttcatgaatttttagatggcccaattttttgtccgtcagcagaacatcctaatccaatt
actggagaagtaccaccagtcactcttggacatgaaatgtctggggttgtaaattttata
ggtgaaggagtaagcggacttaaagtgggtgaccatgtcgttgtcgaaccttatatcgtt
cccgaagggactgatacaagtgaaactggacattataacctctcagaaggttcaaacttt
attggtttgggcggaaatggtggaggattggctgaaaaaatttctgttgatgaacgttgg
gttcacaaaattcctgataacttaccattggatgaagccgctctaattgagccactatca
gttggctatcacgctgttgaacgagcaaatttaagtgaaaagagtacggtattagttgtt
ggtgctggaccaattggactattaactgctgccgttgcaaaagcgcaaggacatattgtt
atcatcagtgaacctagtggacttcgtcgtaaaaaagcacaagaagcacaagttgctgat
tatttcttcaatccaattgaagatgacattcaagctaaagttcatgaaattaatgaaaaa
ggagtggacgcagcctttgaatgtacctctgtccaaccgggatttgacgcttgtctagat
gcgattcgtatgggtggaacagttgtcattgttgcaatttggggcaagcctgctagtgtt
gatatggcaaaattagtaatcaaagaagctaaccttttaggaacgattgcttataataac
actcatccaaaaacaattgatttagtatcaacaggtaaaataaaattggaccaattcatc
acagctaaaatcggtttggatgatttgattgataaaggattcgatacgctgattcatcat
aatgaaacagctgttaaaattttagtttcacccactggtaaaggtttataa

DBGET integrated database retrieval system